IndexAntibodies & CytokinesCytokines & Growth F.

Deutsch

rHuTGF-b2 Active

1 mg

Recombinant human TGF-b2 produced in plants.

4712,50 € (EUR)

plus 19% VAT and
shipping costs

Recombinant human TGF-?2 is a 27.08 kDa protein composed of two identical 118 amino acid peptide chains linked by a single disulfide bond. TGF–? is a family of five related cytokines that have been shown on a wide variety of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-? (TGF-?1, TGF-?2 and TGF-?3) signal through the same receptor and elicit similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing. It is produced by transient expression of TGF-?2 in non-transgenic plants. Recombinant human TGF-?2 contains a 6-His-tag at the N-terminal end and is purified by sequential chromatography (FPLC). This product contains no animal –derived components or impurities. Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS.

rHuTGF-b2 Active 1 mg - RF003-1

rHuTGF-b2 Active 1 mg - RF003-1

Productnumber: RF003-1

Deutsch rHuTGF-b2 Aktiv 1 mg
Antikörper & Zytokine

Application: cell culture, assays

Source: Nicotiana benthamiana

Technical Data: Purity: >97% (FPLC); one band in SDS-PAGE; p.I.: 7.72; MW=13.5 kDa (single chain); Endotoxin: < 0.04 EU/mg protein (LAL method); molecular formula: C602H909N167O171S10.

Shipping/Storing-Information: shipped at RT, stored at -20°C

Productdetails:


pdf rHuTGF-b2 Active 1 mg

Documentation:


pdf rHuTGF-b2 Active 1 mg

Matchcode: Recombinant Human Transforming Growth Factor-Beta 2