rHuTGF-b2 Active 5 µg

Recombinant human TGF-b2 produced in plants.

Recombinant human TGF-?2 is a 27.08 kDa protein composed of two identical 118 amino acid peptide chains linked by a single disulfide bond. TGF–? is a family of five related cytokines that have been shown on a wide variety of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-? (TGF-?1, TGF-?2 and TGF-?3) signal through the same receptor and elicit similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing. It is produced by transient expression of TGF-?2 in non-transgenic plants. Recombinant human TGF-?2 contains a 6-His-tag at the N-terminal end and is purified by sequential chromatography (FPLC). This product contains no animal –derived components or impurities. Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS.