IndexAntibodies & CytokinesCytokines & Growth F.

Deutsch

rHuVEGF121 Sf9

1 mg

Recombinant Human Vacular Endothelial Growth Factor-121-Sf9

4850,00 € (EUR)

plus 19% VAT and
shipping costs

Recombinant Human VEGF-121 produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain of 121 amino acids and a molecular mass of approximately 36kDa. VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates. Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g. stimulation monocyte/macrophage migration, neurons, cancer cells, kidney epithelial cells ). VEGF mediates increased vascular permeability, induces angiogenesis, vasculogenesis and endothelial cell growth, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Synonyms: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.

rHuVEGF121 Sf9 1 mg - C6389.1000

rHuVEGF121 Sf9 1 mg - C6389.1000

Productnumber: C6389.1000

Deutsch rHuVEGF121 Sf9 1 mg
Antik÷rper & Zytokine

Source: Sf9-cells

Technical Data: Purity: >95% (by RP-HPLC, IEX-HPLC, SDS-PAGE). Less than 1% dimers and aggregates. Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized from a solution containing 50mM acetic acid. Endotoxin: Less than 0.1 ng/Ág (IEU/Ág) rHuVEGF. The amino acid sequence of the protein is as follows APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECV PTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPR.

Shipping/Storing-Information: shipped at RT, stored at -20░C

Documentation:


pdf rHuVEGF121 Sf9 1 mg

Productdetails:


pdf rHuVEGF121 Sf9 1 mg

Matchcode: Recombinant Human Vacular Endothelial Growth Factor-121-Sf9