IndexAntibodies & CytokinesPolyclonals

Deutsch

Rabbit anti-human BMP-7 antibody

100 µg

Polyclonal Rabbit anti-human BMP-7 antibody.

225,74 € (EUR)

plus 19% VAT and
shipping costs

Polyclonal IgG Anti Human BMP 7 is developed in rabbit using recombinant Human BMP 7 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH.

Rabbit anti-human BMP-7 antibody 100 µg - RF0017

Rabbit anti-human BMP-7 antibody 100 µg - RF0017

Productnumber: RF0017

Deutsch Kaninchen anti-human BMP-7 Antikörper 100 µg
Antikörper & Zytokine

Application: Western Blot: to detect human BMP 7 by WB analysis this IgG can be used in a dilution of 1/500.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping/Storing-Information: shipped on blue-ice, store at -20°C

Documentation:


pdf Rabbit anti-human BMP-7 antibody 100 µg