Kaninchen anti-human BMP-7 Antikörper 100 µg
Antikörper & Zytokine
Rabbit anti-human BMP-7 antibody 100 µg
|
Polyclonal Rabbit anti-human BMP-7 antibody | |
|
Polyclonal IgG Anti Human BMP 7 is developed in rabbit using recombinant Human BMP 7 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH. |
Rabbit anti-human BMP-7 antibody 100 µg - RF0017 |
Documentation:
Rabbit anti-human BMP-7 antibody 100 µg
Productnumber: RF0017
Application: Western Blot: to detect human BMP 7 by WB analysis this IgG can be used in a dilution of 1/500.
Source: Rabbit
Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.
Shipping/Storing-Information: shipped on blue-ice, store at -20°C
