Kaninchen anti-human Interferon a-2a Antikörper 100 µg
Antikörper & Zytokine
Rabbit anti-human Interferon a-2a antibody 100 µg
|
Polyclonal Rabbit anti-human Interferon a-2a antibody | |
|
Polyclonal IgG Anti Human Interferon ? 2a is developed in rabbit using recombinant Human Interferon ? 2a expressed in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. |
Rabbit anti-human Interferon a-2a antibody 100 µg - RF0013 |
Documentation:
Rabbit anti-human Interferon a-2a antibody 100 µg
Productnumber: RF0013
Application: ELISA: to detect Human Interferon ? 2a by indirect ELISA a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1ng /well of human Interferon ? 2a. Western Blot: to detect human Interferon ? 2a by WB analysis this antibody can be used in a dilution of 1/1,500.
Source: Rabbit
Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.
Shipping/Storing-Information: shipped on blue-ice, store at -20°C
