Kaninchen anti-human Myostatin Antikörper 1 mg
Antikörper & Zytokine
Rabbit anti-human Myostatin antibody 1 mg
|
Polyclonal Rabbit anti-human Myostatin antibody | |
|
Polyclonal IgG Anti Human Myostatin is developed in rabbit using recombinant Human Myostatin produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS. |
Rabbit anti-human Myostatin antibody 1 mg - RF0022-1 |
Documentation:
Rabbit anti-human Myostatin antibody 1 mg
Productnumber: RF0022-1
Application: Western Blot: to detect human Myostatin by WB analysis this IgG can be used in a dilution of 1/500. For optimal results we recommend overnight incubation.
Source: Rabbit
Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.
Shipping/Storing-Information: shipped on blue-ice, store at -20°C
