IndexAntibodies & CytokinesPolyclonals

Deutsch Kaninchen anti-human Myostatin Antikörper 1 mg
Antikörper & Zytokine

Rabbit anti-human Myostatin antibody 1 mg

Polyclonal Rabbit anti-human Myostatin antibody

866,25 € (EUR)
plus 19% VAT and shipping costs

Rabbit anti-human Myostatin antibody 1 mg - RF0022-1

Polyclonal IgG Anti Human Myostatin is developed in rabbit using recombinant Human Myostatin produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS.

Rabbit anti-human Myostatin antibody 1 mg - RF0022-1

Documentation:

 pdf Rabbit anti-human Myostatin antibody 1 mg

Productnumber: RF0022-1

Application: Western Blot: to detect human Myostatin by WB analysis this IgG can be used in a dilution of 1/500. For optimal results we recommend overnight incubation.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping/Storing-Information: shipped on blue-ice, store at -20°C