IndexAntibodies & CytokinesPolyclonals

Deutsch Kaninchen anti-human Myostatin Antikörper 100 µg
Antikörper & Zytokine

Rabbit anti-human Myostatin antibody 100 µg

Polyclonal Rabbit anti-human Myostatin antibody

204,75 € (EUR)
plus 19% VAT and shipping costs

Rabbit anti-human Myostatin antibody 100 µg - RF0022

Polyclonal IgG Anti Human Myostatin is developed in rabbit using recombinant Human Myostatin produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS.

Rabbit anti-human Myostatin antibody 100 µg - RF0022

Documentation:

 pdf Rabbit anti-human Myostatin antibody 100 µg

Productnumber: RF0022

Application: Western Blot: to detect human Myostatin by WB analysis this IgG can be used in a dilution of 1/500. For optimal results we recommend overnight incubation.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping/Storing-Information: shipped on blue-ice, store at -20°C