Kaninchen anti-human Myostatin Antikörper 100 µg
Antikörper & Zytokine
Rabbit anti-human Myostatin antibody 100 µg
|
Polyclonal Rabbit anti-human Myostatin antibody | |
|
Polyclonal IgG Anti Human Myostatin is developed in rabbit using recombinant Human Myostatin produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS. |
Rabbit anti-human Myostatin antibody 100 µg - RF0022 |
Documentation:
Rabbit anti-human Myostatin antibody 100 µg
Productnumber: RF0022
Application: Western Blot: to detect human Myostatin by WB analysis this IgG can be used in a dilution of 1/500. For optimal results we recommend overnight incubation.
Source: Rabbit
Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.
Shipping/Storing-Information: shipped on blue-ice, store at -20°C
