IndexAntibodies & CytokinesPolyclonals

Deutsch

Rabbit anti-human TFPI-2 antibody

1 mg

Polyclonal Rabbit anti-human TFPI-2 antibody.

955,04 € (EUR)

plus 19% VAT and
shipping costs

Polyclonal IgG Anti Human TFPI-2 is developed in rabbit using recombinant Human Kunitz domain 1 from TFPI-2 in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: GAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.

Rabbit anti-human TFPI-2 antibody 1 mg - RF0012-1

Rabbit anti-human TFPI-2 antibody 1 mg - RF0012-1

Productnumber: RF0012-1

Deutsch Kaninchen anti-human TFPI-2 Antikörper 1 mg
Antikörper & Zytokine

Application: ELISA: to detect Human TFPI-2 by indirect ELISA a dilution of at least 1/300 of this antibody is required. Western Blot: to detect human TFPI-2 by WB analysis this IgG can be used in a dilution of 1/500.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping/Storing-Information: shipped on blue-ice, store at -20°C

Documentation:


pdf Rabbit anti-human TFPI-2 antibody 1 mg