Kaninchen anti-human TFPI-2 Antikörper 1 mg
Antikörper & Zytokine
Rabbit anti-human TFPI-2 antibody 1 mg
|
Polyclonal Rabbit anti-human TFPI-2 antibody | |
|
Polyclonal IgG Anti Human TFPI-2 is developed in rabbit using recombinant Human Kunitz domain 1 from TFPI-2 in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: GAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV. |
Rabbit anti-human TFPI-2 antibody 1 mg - RF0012-1 |
Documentation:
Rabbit anti-human TFPI-2 antibody 1 mg
Productnumber: RF0012-1
Application: ELISA: to detect Human TFPI-2 by indirect ELISA a dilution of at least 1/300 of this antibody is required. Western Blot: to detect human TFPI-2 by WB analysis this IgG can be used in a dilution of 1/500.
Source: Rabbit
Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.
Shipping/Storing-Information: shipped on blue-ice, store at -20°C
