IndexAntibodies & CytokinesPolyclonals

Deutsch

Rabbit anti-human TGF-▀2 antibody

1 mg

Polyclonal Rabbit anti-human TGF-▀2 antibody.

1221,29 € (EUR)

plus 19% VAT and
shipping costs

Polyclonal IgG Anti Human TGF?-2 is developed in rabbit using recombinant Human TGF?-2 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS.

Rabbit anti-human TGF-▀2 antibody 1 mg - RF0015-1

Rabbit anti-human TGF-▀2 antibody 1 mg - RF0015-1

Productnumber: RF0015-1

Deutsch Kaninchen anti-human TGF-▀2 Antik÷rper 1 mg
Antik÷rper & Zytokine

Application: Western Blot: to detect human TGF▀-2 by WB analysis this IgG can be used in a dilution of 1/500 - 1/1,000.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping/Storing-Information: shipped on blue-ice, store at -20░C

Documentation:


pdf Rabbit anti-human TGF-▀2 antibody 1 mg