IndexAntibodies & CytokinesPolyclonals

Deutsch Kaninchen anti-human TGF-ß2 Antikörper 1 mg
Antikörper & Zytokine

Rabbit anti-human TGF-ß2 antibody 1 mg

Polyclonal Rabbit anti-human TGF-ß2 antibody

1107,75 € (EUR)
plus 19% VAT and shipping costs

Rabbit anti-human TGF-ß2 antibody 1 mg - RF0015-1

Polyclonal IgG Anti Human TGF?-2 is developed in rabbit using recombinant Human TGF?-2 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS.

Rabbit anti-human TGF-ß2 antibody 1 mg - RF0015-1

Documentation:

 pdf Rabbit anti-human TGF-ß2 antibody 1 mg

Productnumber: RF0015-1

Application: Western Blot: to detect human TGFß-2 by WB analysis this IgG can be used in a dilution of 1/500 - 1/1,000.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping/Storing-Information: shipped on blue-ice, store at -20°C