Für die Filterung wurden keine Ergebnisse gefunden!
Rinderserumalbumin (BSA) - Fettsäurefrei
Kristallisiertes Albumin ist ein Albumin Fraktion V, das dreimal bei Temperaturen unter 0°C umkristallisiert wurde. Dadurch enthält man ein sehr natives Protein, das frei von Kohlehydraten, Globulinen und Fettsäuren ist.
ab 112,88 € *
Rinderserumalbumin (BSA) Fraction V (pH 7,0)
Rinderserumalbumin (BSA) Fraction V (pH 7,0) ist ein lyphilisiertes Albumin der Standardreinheit. Serumalbumin vom Rind (BSA) wird häufig zur Stabilisierung von Proteinen den entsprechenden Puffern zugesetzt. Die Konzentration liegt in...
ab 73,13 € *
Albumin aus Hühnereiweiss - Ovalbumin
Albumin aus Hühnereiweiß (Ovalbumin) ist ein phosphoryliertes Glycoprotein das 385 Aminosäurereste enthält und ein Molekulargewicht von 42,7 kDa besitzt. Hühnereiweiß ist der mengenmäßig größte Proteinbestandteil von Eiklar. Wird in der...
ab 226,29 € *
Ovalbumin (Rohextrakt)
Albumin aus Hühnerei (Ovalbumin). Rohextrakt: mind. 80% Proteingehalt.
ab 79,57 € *
rek. humanes Serumalbumin (rHSA) - Lipidfrei
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 249,31 € *
Rinderalbumin für EIA und RIA
IgG-freies Rinderserumalbumin. Besonders als Blockierungs- und Stabilisierungsreagenz in allen Antikörper-vermittelten Nachweissystemen empfohlen. Zusätzlich zur IgG-Freiheit zeigt dieses Albumin auch einen sehr geringen Fettsäuregehalt...
ab 61,54 € *
humanes LL-37 - scrambled -...
LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 241,40 € * 284,00 € *
Rinderalbumin (BSA), sehr niedriges Endotoxin
Hitzebehandeltes Albumin (entsprechend 10 Stunden bei 60°C). IgG nicht nachweisbar. Frei von Mycoplasma und Rinderviren. Frei von Caprylsäure und von anderen Stabilisatoren die für Zelllinien toxisch wirken könnten. Auf die Verwendung in...
ab 86,05 € *
FLAG-Peptid - DYKDDDDK
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 140,00 € * 175,00 € *
3x FLAG Peptid - DYKDDDDK-DYKDDDDK-DYKDDDDK
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die Immunaffinitätschromatographie entwickelt. Das Peptid erlaubt die kompetitive Elution von Proteinen...
ab 246,13 € * 307,66 € *
humanes LL-37...
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its...
ab 252,49 € * 315,62 € *
rek. humanes Serumalbumin (rHSA)
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 583,50 € *
rek. humanes Serumalbumin (rHSA) - aus Pflanzen
Recombinant Human HSA produced in mammalians is a single, glycosylated, polypeptide chain of 585 amino acids and a molecular mass of 66441 Dalton. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that...
ab 382,13 € *