by category | alphabetically | by productnumber

Product Index

A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
0 1 2 3 4 5 6 7 8 9

Products catalogue for download in pdf-files

Each pdf-file contains one section of the Genaxxon catalogue.

  1.     » Special offers section »
  2. pdf Services
  3. pdf DNA/Protein Purification
  4. pdf PCR-Products
  5. pdf Cloning and Ligation
  6. pdf Molecular Biology
  7. pdf Cell Biology
  8. pdf Chemicals
  9. pdf Consumables

Sorted by Productnumber

Every product is listed once only, varying package sizes you will find in the main catalogue.


A1001.1000 Mouse Anti-ACTH Monoclonal Antibody C terminal Reactive.
A1002.1000 Mouse Anti-ACTH Monoclonal Antibody N terminal Reactive
A1003.0100 Mouse Anti-Bromodeoxyuridine mAB
A1004.0100 Mouse Anti-FITC Bromodeoxyuridine Monoclonal Antibody
A1005.0100 Mouse Anti-Bromodeoxyuridine FITC conjugated with evans blue.
A1007.0100 Mouse anti-Cyclin D1 (human, rat, mouse)
A1009.0100 Biotin labelled mouse anti-Cyclin D1 (human, rat, mouse)
A1011.0100 Mouse anti-Cyclin D1 (human)
A1012.0100 Mouse anti-Cyclin D1 (human). FITC labelled.
A1014.0050 Mouse anti-Cyclin D1 (human, mouse) IgM
A1015.0100 Mouse anti-Cyclin D2 (human)
A1016.0100 Mouse anti-Cyclin D2 (human). FITC labeled.
A1017.0100 Mouse anti-Cyclin D2 (human, mouse, rat)
A1018.5000 Mouse anti-Cyclin D2 (human, mouse)
A1019.0100 Mouse anti-Cyclin D3 (human)
A1020.0100 Mouse anti-Cyclin D3 (human). FITC labeled.
A1021.0100 Mouse anti -Cyclin D3 (human, mouse, rat, monkey)
A1021.0200 Mouse anti-Cyclin D3 (human, mouse, rat, monkey)
A1022.0100 Mouse anti-Cyclin DX (human) D1/D2/D3 common epitope
A1023.0100 Mouse anti-Cyclin DX (human) D1/D2/D3 common epitope FITC labelled.
A1024.0100 Mouse anti-Cyclin B1 (human).
A1025.0100 Mouse anti-Cyclin B1 (human). FITC labelled.
A1026.1000 Rabbit anti-CEA antibody
A1027.0100 Mouse anti Chromogranin A (human)
A1030.0100 Anti Clathrin Antigen
A1031.0050 Mouse anti-Clathrin Heavy Chain monoclonal antibody
A1032.1000 Mouse anti-Collagen type IV
A1033.0250 Polyclonal Antibody to Collagen Type IV
A1034.0200 Mouse anti Type VII Collagen
A1035.0200 Mouse anti Chromogranin A (human)
A1036.0200 Mouse anti Chromogranin A (human). Without BSA and NaN3.
A1037.0200 Mouse anti Chromogranin A (human). Biotin labelled.
A1038.0200 Mouse anti Chromogranin A (human)
A1039.0200 Mouse anti Chromogranin A (human). Without BSA and NaN3.
A1040.0150 Mouse anti-Clathrin Heavy Chain monoclonal antibody
A1043.5100 Anti Clathrin Antigen
A1044.0500 Rat Anti-Mouse IL-2 receptor (rAmuIL-2R)
A1045.0500 Rat Anti-Mouse IL-2 (rAmuIL-2)
A1046.0500 Rat Anti-Mouse IL-4 (rAmuIL-4)
A1047.0500 Rat Anti-Mouse IL-10 (rAmuIL-10)
A1048.0500 Rat Anti-Mouse IL-12 p40 (rAmuIL-12p40)
A1049.0500 Mouse Anti-Human IL-1 beta (mAHuIL-1b)
A1050.0500 Mouse Anti-Human IL-2 (mAHuIL-2)
A1051.0500 Mouse Anti-Human IL-2 receptor (mAHuIL-2r)
A1052.0500 Mouse Anti-Human IL-3 (mAHuIL-3)
A1053.0500 Mouse Anti-Human IL-4 (mAHuIL-4)
A1054.0500 Mouse Anti-Human IL-6 (mAHuIL-6)
A1055.0500 Mouse Anti-Human IL-7 (mAHuIL-7)
A1056.0500 Mouse Anti-Human IL-8 (mAHuIL-8)
A1057.0500 Mouse Anti-Human IL-10 (mAHuIL-10)
A1058.0500 Mouse Anti-Human IL-15 (mAHuIL-15)
A1060.0500 Mouse Anti-Human Neurotropin 4 (mAHuNT-4)
A1061.0500 Mouse Anti-Human Macrophage Inflammatory-1 alpha (mAHuMIP-1a)
A1062.0500 Mouse Anti-Human Macrophage/Monocyte Chemotactic & Activating Factor
A1063.0500 Mouse Anti-Human Macrophage/Monocyte Chemotactic Protein 3 / MARC
A1064.0500 Mouse Anti-Human Macrophage Inflammatory-3 (mAHuMIP-3)
A1065.0500 Mouse Anti-Human Interferon-alpha (mAHuIFN-a)
A1066.0500 Mouse Anti-Human Interferon-gamma (mAHuIFN-g)
A1067.0500 Mouse Anti-Human Tumor Necrosis Factor-alpha (mAHuTNF-a)
A1068.0500 Mouse Anti-Human Vascular Endothelial Cell Growth Factor (mAHuVEGF)
A1069.0500 Mouse Anti-Human Eotaxin-1 (mAHuEotaxin-1)
A1070.0500 Mouse Anti-Human Eotaxin-2 (mAHuEotaxin-2)
A1072.0500 Mouse Anti-Human Brain-Derived Neurotrophic Factor (mAHuBDNF)
A1073.0500 Mouse Anti-Human Granulocyte Macrophage Colony Stimulating Factor
A1074.0500 Mouse Anti-Human Granulocyte Colony Stimulating Factor
A1075.0500 Mouse Anti-Human IL-1Ra (mAHuIL-1RA)
A1076.0500 Rat Anti-Mouse CD3
A1077.0500 Rat Anti-Mouse CD4
A1078.0500 Rat Anti-Mouse CD8
A1079.0500 Mouse Anti-Mouse CD8.2
A1080.0500 Rat Anti-Mouse CD11a
A1081.0500 Rat Anti-Mouse CD45
A1082.0500 Rat Anti-Mouse CD44
A1083.0500 Rat Anti-Mouse Thy-1
As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B. The biological activity of Activin A can be neutralized by inhibins and by the diffusible TGF-B antagonist, Follistatin. Amino acid sequence: HHHHHHGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSG
C4001.0500 Alpha MEM Eagle without nucleosides, without glutamine
C4002.0500 Alpha MEM Eagle without nucleosides, with glutamine
C4003.0500 Alpha MEM Eagle with nucleosides, with glutamine
C4004.0500 Alpha MEM Eagle with nucleosides, without glutamine
C4005.0500 Alpha MEM Eagle with nucleosides, with stab. Glutamine
C4006.0500 Alpha MEM Eagle without nucleosides, with stab. Glutamine
C4007.0500 Basal Medium (Eagle) with EBSS without glutamine
C4008.0500 Basal Medium (Eagle) with EBSS with glutamine
C4009.0500 Basal Medium (Eagle) with EBSS without NaHCO3
C4010.0500 Basal Medium (Eagle) with EBSS without glutamine, with HEPES
C4011.0500 Basal Medium (Eagle) with HBSS without glutamine
C4012.0500 Basal Medium (Eagle) with HBSS with glutamine
C4013.0500 Basal Medium (Eagle) with HBSS with glutamine, with HEPES
C4014.0500 Basal Medium (Eagle) with HBSS (10X)
C4015.0500 BSK-H Medium with HBSS without glutamine
C4016.0500 BSK-H Medium with HBSS without glutamine, with Rabbit Serum
C4017.0500 DMEM:F12, 1:1 Mix with stab. glutamine, with HEPES
C4018.0500 DMEM:F12, 1:1 Mix w/o glutamine
C4019.0500 DMEM:F12, 1:1 Mix with glutamine
C4020.0500 DMEM:F12, 1:1 Mix w/o phenol red
C4021.0500 DMEM:F12, 1:1 Mix with stab. Glutamine
C4022.0500 DMEM:F12, 1:1 Mix w/o glutamine, w/o glucose
C4023.0500 DMEM:F12, 1:1 Mix with glutamine, with 15mM HEPES
C4024.0500 DMEM w/o glutamine, with 1g/L Glucose
C4025.0500 DMEM with glutamine, with 1g/L Glucose
C4026.0500 DMEM with stab. Glutamine, with 1g/L Glucose
C4027.0500 DMEM w/o glutamine, w/o glucose, with Sodium pyruvate
C4028.0500 DMEM with stab. glutamine, with 4.5g/L glucose, with Sodium pyruvate
C4029.0500 DMEM w/o glutamine, w/o Ca
C4030.0500 DMEM w/o glutamine, w/o glucose, w/o Sodium pyruvate, w/o Cystine, w/o Methionine
C4031.0500 DMEM w/o glutamine, w/o Isoleucine
C4032.0500 DMEM with glutamine, w/o glucose, with Sodium pyruvate
C4033.0500 DMEM w/o glutamine, with 4.5g/L glucose, w/o Sodium pyruvate
C4034.0500 DMEM with glutamine, with 4.5g/L glucose, w/o Sodium pyruvate
C4035.0500 DMEM w/o glutamine, with Sodium pyruvate, with 4.5g/L glucose
C4036.0500 DMEM with glutamine, with 4.5g/L glucose, with Sodium pyruvate
C4037.0500 DMEM with lutamine, with 4.5g/L glucose, with Sodium pyruvate, with 25 mM Hepes
C4038.0500 DMEM with glutamine, with 4.5g/L glucose, w/o Sodium pyruvate, with 25mM Hepes
C4039.0500 DMEM w/o Cysteine, w/o Methionine, w/o glutamine, w/o glucose
C4040.0500 DMEM with stab. glutamine, with 4.5g/L glucose, w/o Sodium pyruvate
C4041.0500 DMEM w/o glutamine, with 4.5g/L glucose, w/o NEAAs
C4042.0500 EMEM Fibroblasts
C4043.0500 Glasgow-MEM (BHK 21), with glutamine, without Tryptose/Phosphate Bouillon
C4044.0500 Glasgow-MEM (BHK 21), with glutamine, with Tryptose/Phosphate Bouillon
C4045.0500 Glasgow-MEM (BHK 21), without L-Glutamine, without Tryptose/Phosphate Bouillon
C4046.0500 Glasgow-MEM (BHK 21), without L-Glutamine, with Tryptose/Phosphate Bouillon
C4047.0500 Ham´s F-10 Medium without phenol red, without glutamine
C4048.0500 Ham´s F-10 Medium with glutamine
C4049.0500 Ham´s F-10 Medium with stab. glutamine
C4050.0500 Ham´s F-10 Medium with stab. glutamine, without phenol red
C4051.0500 Ham´s F-10 Medium with glutamine, with 25 mM Hepes
C4052.0500 Ham´s F-12 Medium with glutamine
C4053.0500 Ham´s F-12 Medium without glutamine
C4054.0500 Ham´s F-12 Medium special
C4055.0500 Ham´s F-12 Medium with stab. glutamine
C4056.0500 Iscove´s Modified Dulbecco´s Medium with glutamine, with 20 mM Hepes
C4057.0500 Iscove´s Modified Dulbecco´s Medium with glutamine, with 25 mM Hepes
C4058.0500 Iscove´s Modified Dulbecco´s Medium without glutamine, with 25 mM Hepes
C4059.0500 Iscove´s Modified Dulbecco´s Medium without Hepes, without glutamine
C4060.0500 Iscove´s Modified Dulbecco´s Medium with glutamine, without Hepes
C4061.0500 Iscove´s Modified Dulbecco´s Medium with 25 mM Hepes, with stab. glutamine
C4062.0500 Leibovitz´s L-15 Medium without glutamine
C4063.0500 Leibovitz´s L-15 Medium with glutamine
C4064.0500 Leibovitz´s L-15 Medium with stab. glutamine
C4065.0500 McCoy´s 5A Medium (Modified) with glutamine
C4066.0500 McCoy´s 5A Medium (Modified) with stab. glutamine
C4067.0500 McCoy´s 5A Medium (Modified) with glutamine, with 25 mM Hepes
C4068.0500 Medium 199 with Earle´s BSS without glutamine, with 2.2 g/L NaHCO3
C4069.0500 Medium 199 with Earle´s BSS with glutamine, with 0.35 g/L NaHCO3
C4070.0500 Medium 199 with Earle´s BSS without glutamine, with 0.35 g/L NaHCO3
C4071.0500 Medium 199 with Earle´s BSS with glutamine, with 2.2 g/L NaHCO3
C4072.0500 Medium 199 with Earle´s BSS with glutamine, with 25 mM Hepes, with 2.2 g/L NaHCO3
C4073.0500 Medium 199 with Earle´s BSS with stab. Glutamine, with 2.2 g/L NaHCO3
C4074.0500 Medium 199 with Earle´s BSS without glutamine, without phenol red, with 25 mM Hepes, with 2.2 g/L NaHCO3
C4075.0500 Medium 199 with Hank´s BSS with glutamine, with 0.35 g/L NaHCO3
C4076.0500 Medium 199 with Hank´s BSS with glutamine, with 25 mM Hepes, with 0.35 g/L NaHCO3
C4077.0500 MEM Eagle with Earle´s BSS w/o glutamine, w/o Cysteine and Methionine, with 2.2g/L NaHCO3
C4078.0500 MEM Eagle with Earle´s BSS w/o glutamine, with 2.2g/L NaHCO3
C4079.0500 MEM Eagle with Earle´s BSS with glutamine, with 2.2g/L NaHCO3
C4080.0500 MEM Eagle with Earle´s BSS with glutamine, with 20mM Hepes, with 2.2g/L NaHCO3
C4081.0500 MEM Eagle with Earle´s BSS w/o glutamine, w/o NaHCO3
C4082.0500 MEM Eagle with Earle´s BSS w/o glutamine, with 20mM Hepes, w/o NaHCO3
C4083.0500 MEM Eagle with Earle´s BSS with stab. glutamine, with 2.2g/L NaHCO3
C4084.0500 MEM Eagle with Earle´s BSS w/o glutamine, with 25mM Hepes, with 2.2g/L NaHCO3
C4085.0500 MEM Eagle with Earle´s BSS with stab. glutamine, with 25mM Hepes, with 2.2g/L NaHCO3
C4086.0500 MEM Eagle with Earle´s BSS with glutamine, with NEAA, with 2.2g/L NaHCO3
C4087.0500 MEM Eagle with Earle´s BSS with D-Valine, w/o glutamine, with 2.2g/L NaHCO3
C4088.0500 DMEM with glutamine, with HEPES
C4089.0500 MEM Eagle with Hank´s BSS w/o glutamine, with 0.35g/L NaHCO3
C4090.0500 MEM Eagle with Hank´s BSS with glutamine, with 0.35g/L NaHCO3
C4091.0500 MEM Eagle with Hank´s BSS with stab. glutamine, w/o NaHCO3
C4092.0500 MEM Eagle with Hank´s BSS w/o glutamine, with 25mM Hepes, with 0.35g/L NaHCO3
C4093.0500 MEM Eagle with Hank´s BSS with glutamine, with 0.60g/L NaCHO3
C4094.0500 RPMI 1640 w/o glutamine, with 2.0g/L NaHCO3
C4095.0500 RPMI 1640 with glutamine, with 2.0g/L NaHCO3
C4096.0500 RPMI 1640 with stab. glutamine, with 2.0g/L NaHCO3
C4097.0500 DMEM w/o glucose, w/o glutamine, w/o phenol red
C4098.0500 RPMI 1640 w/o glutamine, with 20mM Hepes, with 0.85g/L NaHCO3
C4099.0500 RPMI 1640 w/o Cystine and Methionine
C4100.0500 RPMI 1640 with glutamine, with 20mM Hepes, with 0.85g/L NaHCO3
C4101.0500 RPMI 1640 w/o glutamine, w/o Phenol red, with 2.0g/L NaHCO3
C4102.0500 RPMI 1640 special, with 20mM Hepes, with stab. glutamine, with 1mM Sodium pyruvate, with NEAAs
C4103.0500 RPMI 1640 with 25mM Hepes, w/o glutamine, w/o NaHCO3
C4104.0500 RPMI 1640 w/o glutamine, with 25mM Hepes, with 2.2g/L NaHCO3
C4105.0500 RPMI 1640 w/o glutamine, with 25mM Hepes, with 2.0g/L NaHCO3
C4106.0500 RPMI 1640 with glutamine, with 25mM Hepes, with 2.2g/L NaHCO3
C4107.0500 RPMI 1640 with stab. glutamine, with 25mM Hepes, with 2.2g/L NaHCO3
C4108.0500 RPMI 1640 (10X)
C4109.0500 RPMI 1640 special, with glutamine, w/o amino acids
C4110.0500 RPMI 1640, with glutamine, with 110mg/L pyruvate, with 2.0g/L NaHCO3
C4111.0500 RPMI 1640 w/o Ca, w/o glutamine, with 2.0g/L NaCHO3
C4112.0500 RPMI 1640 with glutamine, w/o Isoleucine, with 2.0g/L NaHCO3
C4113.0500 RPMI 1640 w/o glucose, w/o glutamine, with 2.0g/L NaHCO3
C4114.0500 RPMI 1640 with glutamine, w/o glucose, with 2.0g/L NaHCO3
C4115.0500 RPMI 1640 with glutamine, w/o Phenol red, with 2.0g/L NaHCO3
C4116.0500 RPMI 1640 with stab. glutamine, w/o Phenol red, w/o glucose, with 2.0g/L NaHCO3
C4117.0500 DMEM w/o Cysteine, w/o Methionine, w/o glutamine, with 4.5g/L glucose
C4118.0500 Medium 199 with Hank´s BSS without glutamine, with 0.35 g/L NaHCO3
C4119.0500 Waymouth´s MB 752/1 Medium
C4120.0500 William´s Medium E without glutamine
C4121.0500 William´s Medium E w/o glutamine, w/o Phenol Red
C4122.0500 William´s Medium E with glutamine
C4123.0500 William´s Medium E with stab. glutamine
C4124.1010 Alpha MEM Eagle (powder) with glutamine, without Ribonucleosides
C4125.1010 Alpha MEM Eagle (powder) with glutamine, with Ribonucleosides
C4126.1010 Alpha MEM Eagle (powder) without glutamine, with Ribonucleosides
C4127.1010 Alpha MEM Eagle (powder) with glutamine, with Ribonucleosides, with 25 mM HEPES
C4128.1010 Basal Medium (Eagle) with Earle´s BSS w/o glutamine
C4129.1010 Basal Medium (Eagle) with Earle´s BSS with glutamine
C4130.1010 Basal Medium (Eagle) with Earle´s BSS w/o glutamine, with 25 mM HEPES
C4131.1010 Basal Medium (Eagle) with Earle´s BSS with glutamine, with 25 mM HEPES
C4132.1010 Basal Medium (Eagle) with Hank´s BSS w/o glutamine
C4133.1010 Basal Medium (Eagle) with Hank´s BSS with glutamine
C4134.1010 Basal Medium (Eagle) with Hank´s BSS w/o glutamine, with 25 mM HEPES
C4135.1010 Basal Medium (Eagle) with Hank´s BSS with glutamine, with 25 mM HEPES
C4136.1010 DMEM:F12, 1:1 Mix with glutamine
C4137.1010 DMEM:F12, 1:1 Mix w/o glutamine
C4138.1010 DMEM:F12, 1:1 Mix with glutamine, with 25 mM Hepes
C4139.1010 DMEM:F12, 1:1 Mix w/o glutamine, with 25 mM Hepes
C4140.1010 DMEM:F12, 1:1 Mix with glutamine, with 15 mM Hepes
C4141.1010 DMEM with glutamine, with 1.0 g/L Glucose, with Sodium pyruvate
C4142.1010 DMEM w/o glutamine, with 1.0 g/L Glucose, with Sodium pyruvate
C4143.1010 DMEM with glutamine, with 1.0 g/L Glucose, with Sodium pyruvate, with 25 mM Hepes
C4144.1010 DMEM w/o glutamine, with 1.0 g/L Glucose, with Sodium pyruvate, with 25 mM Hepes
C4145.1010 DMEM with glutamine, with 4.5 g/L Glucose, w/o Sodium pyruvate
C4146.1010 DMEM w/o glutamine, with 4.5 g/L Glucose, w/o Sodium pyruvate
C4147.1010 DMEM with glutamine, with 4.5 g/L Glucose, w/o Sodium pyruvate, with 25 mM Hepes
C4148.1010 DMEM w/o glutamine, with 4.5 g/L Glucose, w/o Sodium pyruvate, with 25 mM Hepes
C4149.1010 DMEM with glutamine, with 4.5 g/L Glucose, with Sodium pyruvate, with 25 mM Hepes
C4150.0500 DMEM w/o glutamine, w/o amino acids, with 1g/L glucose.
C4151.1010 Glasgow-MEM (BHK 21) without Tryptose/Phosphate-Bouillon
C4152.1010 Glasgow-MEM (BHK 21) with Tryptose/Phosphate-Bouillon
C4153.1010 Ham´s F-10 Medium with glutamine
C4154.1010 Ham´s F-10 Medium with glutamine, with 25 mM Hepes
C4155.1010 Ham´s F-12 Medium with glutamine
C4156.1010 Ham´s F-12 Medium with glutamine, with 25 mM Hepes
C4157.1010 Iscove´s Modified Dulbecco´s Medium with glutamine
C4158.1010 Iscove´s Modified Dulbecco´s Medium with glutamine, with 25 mM Hepes
C4159.1010 Leibovitz´s L-15 Medium with glutamine
C4160.1010 Leibovitz´s L-15 Medium with glutamine, with 25 mM Hepes
C4161.1010 McCoy´s 5A Medium (modified) with glutamine
C4162.1010 McCoy´s 5A Medium (modified) with glutamine, with 25 mM Hepes
C4163.1010 Medium 199 with Earle´s BSS with glutamine
C4164.1010 Medium 199 with Earle´s BSS with glutamine, with 25 mM Hepes
C4165.1010 Medium 199 with Hank´s BSS without glutamine
C4166.1010 Medium 199 with Hank´s BSS without glutamine, with 25 mM Hepes
C4167.1010 MEM Eagle with Earle´s BSS without glutamine
C4168.1010 MEM Eagle with Earle´s BSS with glutamine
C4169.1010 MEM Eagle with Earle´s BSS with glutamine, with 25 mM Hepes
C4170.1010 MEM Eagle with Earle´s BSS with glutamine, with NEAA
C4171.1010 MEM Eagle with Earle´s BSS with glutamine, with NEAA, with 25 mM Hepes
C4172.1010 MEM Eagle with Hank´s BSS without glutamine
C4173.1010 MEM Eagle with Hank´s BSS with glutamine
C4174.1010 MEM Eagle with Hank´s BSS with glutamine, with 25 mM Hepes
C4175.1010 MEM Eagle with Hank´s BSS with glutamine, with NEAA
C4176.1010 MEM Eagle with Hank´s BSS with glutamine, with NEAA, with 25 mM Hepes
C4177.1010 RPMI 1640 without glutamine
C4178.1010 RPMI 1640 with L-Glutamine
C4179.1010 RPMI 1640 without glutamine, with 25 mM Hepes
C4180.1010 RPMI 1640 with glutamine, with 25 mM Hepes
C4181.1010 S-MEM Eagle with Earle´s BSS without glutamine
C4182.1010 S-MEM Eagle with Earle´s BSS with glutamine
C4183.1010 Waymouth´s MB 752/1 Medium without glutamine
C4184.1010 Waymouth´s MB 752/1 Medium with glutamine
C4185.1010 William´s Medium E with glutamine
C4186.1010 William´s Medium E with glutamine, with 25 mM Hepes
C4187.0500 IPL-41 Insect Medium without glutamine, without sulfate
C4188.0500 Grace´ Insect Medium without glutamine
C4189.0500 Grace´s Insect Medium with glutamine
C4190.0500 IPL-41 Insect Medium without glutamine
C4191.0500 TNM-FH Insect-Medium
C4192.0500 Schneider´s Drosophila Medium without glutamine
C4193.0500 Schneider´s Drosophila Medium with glutamine
C4194.0500 TC 100 Insect Medium with glutamine
C4195.0500 TC 100 Insect Medium without glutamine
C4196.1010 Grace´s Insect Medium (powder) without glutamine
C4197.1010 Grace´s Insect Medium (powder) with glutamine
C4198.1010 TNM-FH Insect Medium with L-Glutamine
C4199.1010 Schneider´s Drosophila (powder) without glutamine
C4200.1010 Schneider´s Drosophila (powder) with glutamine
C4201.1010 TC 100 Insect Medium (powder) without glutamine
C4202.1010 TC 100 Insect Medium (powder) with glutamine
C4203.1010 TNM-FH Insect Medium without glutamine
C4204.0100 Serafree 1
C4205.0100 Serafree 2
C4206.0100 Serafree 3
C4207.0500 Serafree 4
C4208.0500 Serafree 5
C4209.0500 Serafree 6
C4210.0100 HAT supplement (50X)
C4211.0100 HT supplement (50X)
C4212.0100 HEPES buffer, solution, 1M
C4213.0100 Sodium bicarbonate, solution, 7.5 %
C4214.0100 Sodium pyruvate, solution, 100 mM
C4215.0500 DMEM w/o glutamine, w/o phenol red, with pyruvate
C4216.0100 Human transferrin APO
C4217.0500 D-PBS solution without NaHCO3
C4218.0500 D-PBS solution without NaHCO3 (10X)
C4219.0500 D-PBS solution without Mg, Ca, NaHCO3
C4220.0500 D-PBS solution without Mg, Ca, NaHCO3 (10X)
C4221.0500 Earle´s BBS with phenol red
C4222.0500 Earle´s BBS (10X) with phenol red
C4223.0500 Earle´s BBS without phenol red
C4224.0500 Waymouth´s MB 752/1 Medium
C4225.0500 DMEM with glutamine, w/o glucose, w/o Sodium pyruvate
C4226.1010 DMEM with glutamine, with 4.5 g/L Glucose, with Sodium pyruvate
C4227.0500 Earle´s BBS without Ca and Mg, without phenol red
C4228.0500 Earle´s BBS (10X) without Ca and Mg, without phenol red
C4229.0500 Earle´s BSS without Mg and Ca with phenol red
C4230.0500 DMEM w/o glutamine, w/o glucose, w/o Sodium pyruvate
C4231.0100 Gey´s salt solution
C4232.0100 Hank´s salt solution
C4233.0100 Hank´s salt solution (10X)
C4234.0100 Hank´s salt solution without phenol red
C4235.1000 Hank´s salt solution (10X) without phenol red
C4236.0100 Hank´s salt solution without Ca and Mg
C4237.0100 Hank´s salt solution (10X) without Ca and Mg
C4238.0100 Hank´s salt solution without Ca and Mg, without phenol red
C4239.0100 Hank´s salt solution (10X) without Ca and Mg without phenol red
C4240.0100 Puck´s salt solution A
C4241.1000 Puck´s salt solution A (10X)
C4242.1010 Alpha MEM Eagle (powder) w/o glutamine, without Ribonucleosides
C4243.0100 Tyrode´s salt solution
C4244.5010 D-PBS powder without NaHCO3
C4245.5010 D-PBS powder without Ca, Mg, NaHCO3
C4246.1010 E-BSS powder without NaHCO3
C4247.1010 E-BSS powder without Ca, Mg, NaHCO3
C4248.1010 Gey´s BSS powder without NaHCO3
C4249.1010 H-BSS powder without NaHCO3
C4250.1010 H-BSS powder without Ca, Mg, NaHCO3
C4251.1010 Puck´s salt solution A
C4252.1010 DMEM w/o glutamine, with 4.5 g/L Glucose, with Sodium pyruvate, with 25 mM Hepes
C4253.1010 Tyrode´s salt solution
C4254.0500 MOPS buffer 10X
C4255.0001 Collagenase Typ I
C4256.0500 DMEM w/o glutamine, with HEPES
C4257.0500 DMEM:F12, 1:1 Mix with glutamine, with 25mM HEPES
C4258.0500 Medium 199 with Hank´s BSS (10X) without glutamine, without NaHCO3
C4259.0100 Trypsin, 0.25%
C4259.0110 Trypsin, 2.5% (10X)
C4259.0500 Trypsin, 0.25%
C4259.0510 Trypsin, 2.5% (10X)
C4260.0100 Trypsin/EDTA solution
C4261.0100 Trypsin/EDTA (10X) solution
C4262.0100 Trypsin/EDTA dissolved in PBS
C4263.0100 EDTA (Versene), 1 %, in PBS, without Ca2+ and Mg2+.
C4264.0025 Trypsin powder (1:250)
C4265.0500 DMEM w/o arginine, with glutamine, with Sodium pyruvate, with 4.5g/L glucose
C4266.0500 Medium 199 with Hank´s BSS with 15mM Hepes, with 0.35g/L NaHCO3
C4267.0500 Ham´s F-10 Medium without glutamine
C4268.0500 McCoy´s 5A Medium (Modified) without glutamine, without phenol red
C4269.0500 McCoy´s 5A Medium (Modified) with glutamine, without phenol red
C4270.0500 Ham´s F-12 Medium special without glutamine
C4271.0500 Ham´s F-12 Medium special with glutamine
C4272.0500 Iscove´s Modified Dulbecco´s Medium with 25 mM Hepes, with stab. glutamine, without phenol red
C4273.0500 Basal Medium (Eagle) with EBSS with stab. Glutamine
C4274.0500 Basal Medium (Eagle) with EBSS without phenol red
C4275.0500 Alpha MEM Eagle with nucleosides, with glutamine, without glucose
C4276.0500 Alpha MEM Eagle with nucleosides, with glutamine, with glucose
C4277.0500 Schneider´s Drosophila Medium without glutamine, without L-Methionine
C4278.0100 BME 50X, with glutamin
C4279.0100 BME 50X, without glutamin
C4280.0100 Basal Medium Eagle vitamins
C4281.0100 200 mM L-glutamin (100 X)
C4282.0050 Stable L-glutamin, 200 mM (100 X)
C4282.0100 Stable L-glutamin, 200 mM (100 X)
C4283.0100 MEM amino acid solution (50 X) with glutamine
C4284.0100 MEM amino acid solution (50 X) without glutamine
C4285.0100 MEM NEAA (100X) without Glutamine
C4286.0100 MEM vitamin solution (100 X)
C4287.1000 BME amino acid supplement (50 X) with glutamine
C4288.1000 BME amino acid supplement (50 X) without glutamine
C4289.1000 BME Vitamin (100X)
C4290.1000 MEM NEAA (50X) with glutamine
C4291.1000 MEM NEAA (50X) without glutamine
C4292.0500 TC 100 Insect Medium without glutamine, without sulfate
C4293.0500 Solubiliser for protein expression (solution)
C4294.0001 Solubiliser for protein expression (powder)
C4295.0500 TNM-FH Insect-Medium with L-Glutamine
C4296.0500 TC 100 Insect Medium without glutamine, without L-Methionine
C4297.0000 stable Glutamine
C4299.0500 TNM-FH Insect-Medium with FCS
C4300.0002 Human flt3-ligand, rec.
C4301.1010 Iscove´s Modified Dulbecco´s Medium without glutamine, with 25 mM Hepes
C4302.0500 DMEM w/o glutamine, w/o phenol red, w/o pyruvate
C4303.0002 Human-GDNF, rec.
C4304.0005 ITS-solution (100X)
C4305.0010 DMEM:F12, 1:1 Mix w/o glutamine, with 15 mM Hepes
C4306.0002 rHuGRO gamma (CXCL3)
C4307.0002 rHuGRO beta (CXCL2)
C4308.0002 Human HCC-1 (rHuHCC)
C4309.0005 2-Deoxythymidine
C4310.0001 Collagenase Typ IV
C4311.0500 IPL-41 Insect Medium with glutamine
C4312.1010 William´s Medium E w/o glutamine, w/o Phenol Red
C4313.1010 William´s Medium E w/o glutamine
C4314.1010 William´s Medium E with glutamine, w/o Phenol Red
C4315.1010 William´s Medium E w/o glutamine, with HEPES
C4316.0500 William´s Medium E with stab. Glutamine, w/o Phenol Red
C4317.0500 William´s Medium E w/o glutamine, w/o Glucose
C4318.0500 William´s Medium E w/o glutamine, w/o Glucose, w/o Phenol Red
C4319.0500 William´s Medium E w/o glutamine, w/o Glucose, w/o Sodium pyruvate
C4320.0500 Ham´s F-12 Medium w/o glutamine, w/o Phenol Red
C4321.0500 Ham´s F-12K Medium w glutamine
C4322.0500 Ham´s F-12 Medium special w/o glutamine, w 2.5g/L NaHCO3
C4323.0500 Alpha MEM Eagle w/o Glutamine, w/o nucleosides, w/o Phenol Red
C4324.0010 DMEM w/o L-Glutamine, w/o Glucose, w/o sodium pyruvate, w/o Phenol Red, w/o NaHCO3.
C4325.5010 RPMI 1640 w/o Glucose, w/o Phenol Red
C4326.1010 MEM Eagle with Hank´s BSS w/o glutamine, with NEAA, with 25 mM Hepes
C4327.1010 MEM Eagle with Hank´s BSS w/o glutamine, with NEAA
C4328.1010 MEM Eagle with Hank´s BSS w/o glutamine, with 25 mM Hepes
C4329.0500 DMEM with glutamine, with 1g/L Glucose, w/o Phenol Red
C4330.0500 DMEM with glutamine, with 1g/L Glucose, w/o Phenol Red, w/o sodium pyruvate
C4331.0500 MEM Eagle with Earle´s BSS w/o glutamine, w/o Phenol Red, with 2.2g/L NaHCO3.
C4332.2010 Basal Medium (Eagle) with Earle´s BSS with glutamine, w/o Phenol Red
C4333.0010 Colcemid
C4334.0010 Nocodazole
C4335.0500 Neurogenax
C4336.2010 Neurogenax 27
C4337.0005 Recombinant Human IL-18 (rHuIL-18)
C4338.0100 Insect Profree
C4340.0002 rhuLIF
C4341.0001 Collagenase Typ II
C4342.0005 rHu-MCP-1 (MCAF), rec.
C4343.0002 Human MCP-2 (rHuMCP-2)
C4344.0002 Human MCP-3 (rHuMCP-3)
C4345.0002 Human MCP-4, rec.
C4346.0001 Collagenase Typ III
C4349.0002 Human MIP-1beta, rec.
C4351.0005 Human MIP-3beta, rec.
C4353.0002 Human NAP-2, rec.
C4360.0002 rHuPDGF-AA
C4362.0002 rHuPDGF-AB
C4371.0002 Human TPO, rec.
C4379.0002 Murine Eotaxin, rec.
C4383.0020 Murine IFN-gamma, rec.
C4393.0005 Recombinant Mouse IL-18 (rmIL-18)
C4396.0002 rM-SCF
C4401.0002 Human MIP-4, rec.
C4402.0100 Rat IFN-gamma, rec.
C4406.0002 Rat MCP-1 (MCAF), rec.
C4409.0005 rec. Pig Tumor Necrosis Factor alpha (rp TNF-a)
C4432.0100 LEUCO-Human
C4433.0100 LEUCO-Platelets
C4434.0100 LEUCO-Animal
C4435.0100 LEUCO -Mouse
C4436.0100 LEUCO-Rat
C4437.0100 LEUCO-Special
C4438.0100 LEUCO-Turbo
C4754.0100 Lympho-Paque
C4755.0500 CMRL-1066 without glutamine
C4756.0500 CMRL-1066 with glutamine
C4763.1010 DMEM with glutamine, with 4.5 g/L Glucose, with Sodium pyruvate
C4764.1010 IPL-41 Insect Medium Powder, without Glutamine
C4765.1010 IPL-41 Insect Medium Powder, with Glutamine
C4767.1010 Glasgow-MEM without Tryptose/Phosphate-Bouillon
C4768.1010 Glasgow-MEM with Tryptose/Phosphate-Bouillon
C4769.1010 Iscove´s Modified Dulbecco´s Medium without glutamine, with 25 mM Hepes
C4770.1010 Iscove´s Modified Dulbecco´s Medium without glutamine
C4771.1010 Iscove's Modified Dulbecco's Medium with Earle's salts (modified) without glutamine
C4772.1010 Iscove's Modified Dulbecco's Medium with Earle's salts (modified) with glutamine
C4773.1010 Alpha MEM Eagle without glutamine, without Ribonucleosids and Deoxyribonucleosids
C4774.1010 Waymouth´s MB 752/1 Medium without glutamine, with 20 mM Hepes
C4775.1010 Waymouth´s MB 752/1 Medium with glutamine, with 20 mM Hepes
C6000.1010 Human LeukinFeron (HuLF)
C6001.0005 rec. Human Erythropoetin-alpha (rHuEPO-a)
C6002.0100 rHuman Growth Hormone (rHuGH)
C6004.0100 rec. Human Growth Hormone Binding Protein (rHuGHBP)
C6005.0100 rec. Human Placental Growth Hormone (rHuPGH)
C6006.0100 rec. Human Growth Hormone-20K (rHuGH-20K)
C6007.0100 rec. Ovine Growth Hormone (rOGH)
C6008.0002 rec. Human Hepatocyte Growth Factor (rHuHGF)
C6009.0010 rec. Human sCD40 Ligand/TRAP (rHusCD40)
C6010.0005 rec. Rat Leptin (anti-obesity protein) (rRLeptin-(AOBP))
C6011.0005 rec. Ovine Leptin (anti-obesity protein) (rOLeptin-(AOBP))
C6012.0005 rec. Human Leptin (anti-obesity protein) (rHuLeptin-(AOBP))
C6013.0020 rec. Human Interleukin-1 Receptor Antagonist (rHuIL-1 ra)
C6014.0020 rec. Human Interferon alpha-2a (rHulFN-alpha 2a)
C6015.0020 rec. Human Interferon alpha-2b (rHulFN-alpha 2b)
C6016.0002 rec. Human IFN-beta 1b (rHuIFN-beta 1b)
C6017.0002 rec. Human Interferon beta-1a (rHulFN beta-1a)
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g)
C6019.0002 rec. Human Interleukin-1 beta (rHuIL-1b)
C6020.0002 rec. Murine Interleukin-1 beta (rmIL-1b)
C6021.0002 rec. Human Interleukin-1 alpha (rHuIL-1 alpha)
C6022.0010 rec. Human Interleukin-2 (rHuIL-2)
C6023.0002 rec. Human Interleukin-3 (rHuIL-3)
C6024.0002 rec. Human Interleukin-4 (rHuIL-4)
C6025.0002 rec. Human Interleukin-5 (rHuIL-5)
C6026.0005 rec. Human Interleukin-6 (rHuIL-6)
C6027.0002 rec. Human Interleukin-7 (rHuIL-7)
C6028.0005 rec. Human Interleukin-8 (aa 1-72) (rHuIL-8)
C6029.0002 rec. Human Interleukin-11 (rHuIL11)
C6030.0002 rec. Human Interleukin-15 (rHuIL15)
C6031.0010 rec. Murine Insulin-Like Growth Factor I (rmlGF-I)
C6032.0020 rec. Human Insulin-Like Growth Factor I (rHulGF-I)
C6033.0100 rec. Human Epidermal Growth Factor (rHuEGF)
C6034.0010 rec. Human Fibroblast Growth Factor-basic (rHuFGF-b)
C6035.0002 rec. Human Keratinocyte Growth Factor (rHuKGF)
C6036.0002 rec. Human Vascular Endothelial Growth Factor (rHuVEGF)
C6037.0002 rec. Human Platelet-derived Growth Factor BB (rHuPDGF-BB)
C6038.0002 rec. Human Granulocyte Colony Stimulating Factor (rHuG-CSF)
C6039.0002 rec. Human Granulocyte Macrophage Colony Stimulating Factor (rHuGM-CSF)
C6040.0002 rec. Murine Granulocyte Macrophage Colony Stimulating Factor (rmGM-CSF)
C6041.0010 rec. Human Tumor Necrosis Factor alpha (rHuTNF-a)
C6042.0005 rec. Human Tumor Necrosis Factor beta (rHuTNF-b)
C6043.0005 Human MIP-1alpha, rec.
C6044.0200 rec. Ovine Prolactin (rOPrl)
C6045.0050 rec. HIV-I antigen (rHIV-I)
C6046.0020 rec. HIV-II antigen (rHIV-II)
C6047.0005 rec. Human beta-Nerve Growth Factor (rHuß-NGF)
C6048.0100 rec. Human Parathyroid Hormone (rHuPTH)
C6049.0100 rec. Human Endostatin (rHuEndostatin)
C6050.0010 Human Follicle Stimulating Hormone (HuFSH)
C6051.1010 Human Chorionic Gonadotropin (hCG)
C6052.1000 Human Menopausal Gonadotropin (hMG)
C6053.0005 rec. Murine Tumor Necrosis Factor-alpha (rmTNF-a)
C6055.0002 rec. Human Stem Cell Factor (rHuSCF)
C6056.0002 rec. Human Neurotrophin-3 (rHuNT-3)
C6057.1000 Human Leuprolide (Leuprolide)
C6058.1000 Human Leutenising Hormone Releasing Hormone (LHRH, GnRH)
C6059.0002 rec. Human Stromal Cell-Derived Factor-1 alpha (rHuSDF-1a)
C6060.0100 Human Urokinase (hUK)
C6061.0025 rec. Human Insulin (rHuInsulin)
C6062.0002 rec. Human Bone Morphogenetic Protein-2 (rHuBMP-2)
C6065.0002 Recombinant Human Brain-Derived Neurotrophic Factor (rHuBDNF)
C6066.0005 Recombinant Human Ciliary Neurotrophic Facor (rHuCNTF)
C6067.0010 Recombinant Human Fibroblast Growth Factor-acidic (rHuFGF-a)
C6068.0010 Recombinant Human Insulin Like Growth Factor-II (rHuIGF-II)
C6069.0005 rec. Rat Tumor Necrosis Factor alpha (rr TNF-a)
C6070.0005 rmAcrp30 His
C6071.0005 Recombinant Human Keratinocye Growth Factor-2 (rHuKGF-2)
C6072.0010 Recombinant Human Prolactin (rHuPrl)
C6073.0100 Recombinant Rabbit Prolactin receptor-ECD (rRPrlr-ECD)
C6074.0010 rec. Rat Insulin-Like Growth Factor I (rrlGF-I)
C6075.0002 rHuIGFBP-1
C6076.0002 rec. Human Interleukin-9 (rHuIL-9)
C6077.0002 rec. Human Interleukin-10 (rHuIL-10)
C6078.0002 rec. Rat Interleukin-15 (rrIL15)
C6079.0002 rec. Human Interleukin-20 (rHuIL20)
C6080.0002 rec. Human Interleukin-22 (rHuIL22)
C6081.0002 rM-TPO
C6082.0002 Murine MIP-1alpha, rec.
C6083.0002 Murine MIP-1beta, rec.
C6084.0002 Murine MCP-3 (rMMCP-3)
C6085.0002 rec. Rat Interleukin-1 alpha (rrIL-1a)
C6086.0002 rec. Rat Interleukin-1 beta (rrIL-1b)
C6087.0002 rec. Rat Interleukin-12 (rrIL-12)
C6088.0002 rec. Rat Interleukin-13 (rrIL-13)
C6089.0002 rec. Rat Interleukin-18 (rrIL-18)
C6091.0010 rHuAcrp30 His
C6092.0005 rHuAcrp30
C6093.0002 rHuAcrp30 HEK
C6094.0002 rmAcrp30 HEK
C6095.0002 rHuAcrp30 Tri
C6096.0002 rmAcrp30 Tri
C6097.0005 rHuAcrp30 Glob
C6098.0005 rHuAITRL
C6099.0002 rHuANG-1
C6100.0002 rHuANG-2
C6101.0002 rHuANGPTL-3
C6102.0002 rHuANGPTL-4
C6103.0002 rrAPO-J
C6104.0002 rHuAPO-J
C6105.0005 rHuArtemin
C6106.0005 rHuBD-3
C6107.0002 rHuBDNF
C6108.0005 rHuBAFF
C6109.0005 rHuBAFF-R
C6110.0002 rHuBMPR-1A
C6111.0002 rHuBMP-2
C6112.0002 rHuProBMP-2
C6113.0002 rHuBMP-4
C6114.0002 rHuBMP-6
C6115.0002 rHuBMP-7
C6116.0002 rHuBMP-7 CHO
C6117.0005 rHubeta-NGF
C6118.0005 mbeta-NGF
C6119.0002 rHuPro-NGF
C6120.0002 rHuBNP
C6121.0010 BNP
C6122.0005 rHuBTC
C6123.0005 rbBTC
C6124.0005 rHuCNTF
C6125.0002 rHuCT-1
C6126.0002 rHuCTGF
C6127.0004 rHuCTGF (aa 182-250)
C6128.0010 rHuCTLA-4
C6129.0005 rHuEG-VEGF
C6130.0100 rHuEGF Pichia
C6131.0020 rHuEGF-21 Leu
C6132.0100 rmEGF
C6133.0002 rHuEndoglin Sf9
C6134.0002 rHuEndoglin
C6135.0002 rmEndoglin
C6137.0002 rHuEPO-a Fc
C6138.0002 rHuFGF-a Sf9
C6139.0002 rHuFGF-b Sf9
C6140.0010 rbFGF-b
C6141.0002 rmFGF-b
C6142.0005 rHuFGF-9
C6143.0002 rmFGF-9
C6144.0005 rHuFGF-19
C6145.0002 rHuFGF-21
C6146.0002 rHuFGF-21 His
C6147.0002 rmFGF-21
C6148.0002 rmFGF-21 His
C6149.0002 rHuFGF-22
C6150.0002 rHuFGF-23
C6151.0002 rHuFlt3
C6152.0002 rmFlt3
C6153.0002 rHuFlt3 Sf9
C6154.0005 rHuFST
C6155.0010 rHuGDF-5
C6156.0002 rHuGDNF
C6158.0002 rHuG-CSF His
C6159.0002 rHuG-CSF CHO
C6160.0002 rmG-CSF
C6162.0100 rHuGH Pit-20K
C6163.0100 rHuGH Pla-20K
C6164.0100 rHuGH Pla-22K
C6166.0100 roGHBP
C6167.0100 rbGHBP
C6168.0100 rchGH
C6170.0100 rrGH
C6171.0100 rcGH
C6172.0100 rdGH
C6173.0100 rraGH
C6174.0100 rpGH
C6175.0100 roGH A
C6177.0002 rHuGM-CSF Sf9
C6178.0002 rHuGMCSF/IL3 FP
C6179.0005 rHuGM-CSF His
C6180.0002 rmGM-CSF
C6181.0002 rrGM-CSF
C6182.0002 rpGM-CSF
C6184.0002 rHuHGF CHO
C6185.0002 pHGF
C6186.0002 rHuIFN-a 1
C6187.0020 rHuIFN-a 1a
C6188.0020 rHuIFN-a 1b
C6189.0010 rHuIFN-a 2b Yeast
C6193.0010 rHuIFN-g His
C6196.0010 rpIFN-g
C6197.0002 roIFN-tau
C6198.0010 rHuIRF-1
C6199.0010 rHuIRF-3
C6200.0020 rHuIGF-I des1-3
C6203.0020 rIGF-I Gilthead Seabream
C6205.0005 rHuIGFBP-3
C6206.0005 rHuIGFBP-5
C6207.0005 rHuIGFBP-6
C6209.0005 rHuIL-1a His
C6210.0002 rmIL-1a
C6212.0002 rpIL-1a
C6214.0005 rHuIL-1b His
C6217.0002 rpIL-1b
C6218.0020 rHuIL-1ra
C6219.0010 rHuIL-1ra His
C6221.0005 rmIL-2
C6222.0005 rrIL-2
C6223.0002 rpIL-2
C6224.0005 sHuIL-2R
C6226.0010 rHuIL-3 His
C6227.0002 rmIL-3
C6228.0002 rrIL-3
C6229.0002 rHuIL-3 Sf9
C6230.0002 rHuIL-4 CHO
C6231.0005 rHuIL-4 His
C6232.0002 rmIL-4
C6233.0002 rrIL-4
C6234.0002 rpIL-4
C6236.0002 rrIL-5
C6237.0010 rHuIL-6 His
C6238.0002 rHuIL-6 CHO
C6239.0002 rmIL-6
C6240.0002 rrIL-6
C6241.0002 rpIL-6
C6242.0005 rHusIL-6R
C6244.0002 rHuIL-7 Yeast
C6245.0002 rHuIL-7 His
C6246.0002 rmIL-7
C6248.0002 rmIL-9
C6249.0002 rHuIL-10 CHO
C6251.0002 rHuIL-10 His
C6252.0002 rmIL-10
C6253.0002 rrIL-10
C6254.0002 rpIL-10
C6256.0002 rHuIL-12
C6258.0002 rRIL-12
C6259.0002 rHuIL-12 p35 His
C6260.0002 rHuIL-12 p40 His
C6261.0002 rHuIL-13
C6262.0002 rHuIL-13 His
C6263.0002 rmIL-13
C6266.0002 rHuIL-15 His
C6267.0002 rmIL-15
C6269.0002 rpIL-15
C6270.0005 rHuIL-17
C6271.0005 rmIL-17
C6273.0002 rHuIL-19
C6274.0002 rmIL-19
C6275.0002 rHuIL-20
C6276.0002 rmIL-20
C6277.0002 rHuIL-21
C6279.0002 rHuIL-24
C6280.0002 rHuIL-33
C6283.0025 pInsulin
C6284.0005 rHuKGF-2
C6285.0200 rHuLeptin
C6286.0005 rHuLeptin His
C6287.0200 rmLeptin
C6288.0200 rRLeptin
C6289.0100 roLeptin
C6290.0100 rbLeptin
C6291.0100 rpLeptin
C6295.0100 rraLeptin
C6296.0020 rHuLeptin tA
C6297.0020 rHuLeptin qA
C6298.0020 rmLeptin tA
C6299.0020 rRLeptin tA
C6300.0020 roLeptin tA
C6301.0020 roLeptin qA
C6302.0010 rHuLeptin BD
C6303.0010 rchLeptin BD
C6304.1010 HuLeukinFeron
C6305.0020 rHuLFA-3
C6306.0002 rHuM-CSF
C6307.0002 rmM-CSF
C6308.0001 rHuMIF His-N
C6309.0001 rHuMIF His-C
C6310.0005 rHuMIA
C6311.0005 rHuMidkine
C6312.0002 rHuMyostatin
C6313.0002 rHuMyostatin His
C6314.0001 rHuGDF-8
C6315.0002 rHuNeuroglubin
C6316.0010 rHuNRG1
C6318.0005 rHuNOG
C6319.0002 rHuOmentin
C6320.0010 rHuOPG
C6321.0010 rHuOPG His
C6322.0002 rHuOSM
C6323.0002 rHuPDGF-AA
C6324.0005 rHuPDGF-A
C6325.0002 rHuPDGF-AB
C6326.0002 rHuPDGF-BB Yeast
C6328.0005 rHuPDGF-B
C6329.0002 rmPDGF-BB
C6330.0002 rHuPeriostin
C6331.0005 rHuPleiotrophin
C6332.0010 rbPL
C6333.0010 roPL
C6334.0010 rcPL
C6335.0002 rHuPLGF-1
C6336.0002 rHuPLGF-2
C6337.0002 rHuPGRN
C6338.0010 rHuPrl
C6339.0010 rmPrl
C6340.0010 rrPrl
C6342.0002 rHuPrLrI
C6343.0005 rHuPrl His
C6344.0010 rraPrl-R
C6345.0010 roPrl-R
C6346.0010 rbPrl-R
C6347.0010 roPrl-A
C6348.0002 rHusCD4
C6349.0002 rHuCD4 150
C6350.0002 rHuCD4 (26-226)
C6352.0005 rHuCD4 (125-202)
C6353.0005 rHuCD4 (203-317)
C6354.0010 rHusCD40L/TRAP
C6355.0005 rmsCD40L/TRAP
C6356.0002 rHusRANKL
C6357.0002 rmsRANKL
C6358.0002 rmRELM-alpha
C6359.0005 rHuRELM-b
C6360.0005 rmRELM-g
C6361.0005 rHuResistin
C6362.0005 rHuResistin His
C6363.0005 rmResistin
C6364.0005 rrResistin
C6366.0002 rmSCF
C6367.0002 rRSCF
C6368.0002 rHuSCF Sf9
C6369.0002 rHuTGF-b 1 GST
C6370.0002 rHuTGF-b 3
C6371.0002 rHuTGF-b 3 GST (207 a.a.)
C6372.0005 rHu4-1BBr
C6373.0001 rHuTGF-b 1
C6374.0010 rHuTNF-a His
C6376.0010 rHuTNF-a M
C6378.0005 rHuTNF-b His
C6380.0010 rHuTNFR
C6381.0002 rHuTPO
C6382.0002 rHuTPO CHO
C6383.0002 rmTPO
C6384.0010 rHuTRAIL
C6385.0005 rHuVaspin
C6386.0002 rHuVEGF His
C6387.0002 rHuVEGF CHO
C6388.0002 rHuVEGF121
C6389.0002 rHuVEGF121 Sf9
C6390.0002 rHuVEGF Sf9
C6391.0002 rHuVEGF-C
C6392.0002 rmVEGF Sf9
C6393.0002 rmVEGF
C6394.0002 rrVEGF
C6395.0002 rrVEGF-C
C6396.0002 rrVEGF-C152
C6397.0002 rov-VEGF-E
C6398.0002 rHuVEGFI
C6399.0005 rHuVisfatin
C6400.0005 rmVisfatin
C6401.0002 rmC-10
C6402.0005 rHuEotaxin
C6403.0005 rHuEotaxin-His
C6404.0005 rmEotaxin
C6405.0005 rHuENA-78
C6406.0005 rHuExodus-2
C6407.0005 rHuFractalkine
C6409.0005 rHuIL-8 (aa 1-77)
C6410.0002 rpIL-8 (aa 1-72)
C6411.0010 rHuIL-8 (aa 23-99) His
C6412.0005 rHuGRO-a
C6413.0005 rmKC
C6414.0002 rHuGRO-b
C6415.0005 rmGRO-b
C6416.0005 rrGRO-b
C6417.0002 rHuGRO-g
C6418.0002 rHuHCC
C6419.0002 rHuI-309
C6420.0005 rHuIP-10
C6421.0005 rHuIP-10 His
C6422.0005 rmIP-10
C6423.0005 rHuI-TAC
C6424.0005 rHuI-TAC His
C6425.0002 rHuLymphotactin
C6426.0005 rHuMCP-1/MCAF
C6427.0002 rmMCP-1
C6428.0002 rRMCP-1
C6429.0002 rHuMCP-2
C6430.0002 rHuMCP-3
C6431.0002 rmMCP-3
C6432.0002 rHuMCP-4
C6433.0005 rHuMIG
C6434.0005 rmMIG
C6435.0005 rHuMIP-1a
C6436.0002 rHuMIP-1a His
C6437.0002 rmMIP-1a
C6438.0005 rrMIP-1a
C6439.0002 rHuMIP-1b
C6440.0005 rHuMIP-3b
C6441.0005 rmMIP-3b
C6442.0002 rHuMIP-4
C6443.0002 rHuNAP-2
C6444.0005 HuPF-4
C6445.0005 rHuRantes
C6446.0002 rHuSDF-1a
C6447.0002 rmSDF-1a
C6448.0002 rHuSDF-1b
C6449.0002 rmSDF-1b
C6450.0002 rHuAGRP
C6451.0005 Argipressin
C6452.0020 rHuIAPP
C6453.1000 Antide
C6454.0002 ACTH
C6455.0010 Atosiban
C6456.0001 Buserelin
C6457.0002 rHuProcalcitonin
C6458.1000 sCT
C6459.0250 Cetrorelix
C6461.0010 rhCG
C6462.0005 Deslorelin
C6463.0005 DDAVP
C6464.0002 Elcatonin
C6465.0020 rExendin-4
C6466.0001 Exenatide
C6467.0010 hFSH
C6468.0075 rHuFSH
C6469.0001 GHRL
C6470.0250 hGHRH
C6471.0005 hGHRP-2
C6472.0005 GHRP-6
C6473.0010 rHuGLP-1
C6474.0001 hGLP-1
C6475.0050 Ganirelix
C6476.0004 Glucagon
C6477.0100 rHuGlucagon
C6478.0005 Goserelin
C6479.0020 Hexarelin
C6480.0001 Histrelin
C6481.0010 rhLHRH
C6482.0010 hLHRH
C6483.0200 Lanreotide
C6484.0005 hLeuprolide
C6485.0005 Lypressin
C6486.0001 hMG
C6487.0020 MT-II
C6488.0008 NAF
C6489.0005 OT
C6490.0001 OCT
C6491.0010 rHuOXM
C6492.0001 PMSG
C6493.0001 Secretin
C6494.0001 Sincalide
C6495.0001 Pramlintide
C6496.0002 rHuProguanylin
C6497.0002 rHuProuroguanylin
C6498.0001 SST
C6499.0100 rHuPTH (aa 1-34)
C6500.0200 hPTH (aa 1-34)
C6501.0100 rHuPTH (aa 1-84)
C6502.0100 rHuPTH (aa 7-34)
C6503.0002 rHuSTC-1
C6504.0002 rHuSTC-2
C6505.0050 Terlipressin
C6506.0100 HuTRH
C6507.0010 rHuTSH
C6508.0010 hTSH
C6509.0002 rHuThyrostimulin-B
C6510.0002 rHuThyrostimulin-A
C6511.0005 Trp
C6512.0025 TP-5
C6513.0001 Ta1
C6514.0001 Tb4
C6515.0005 Vasopressin
C6516.0002 rmLIF
D1500.0010 Arachis hypogaea lectin (PNA)
D1501.0010 Artocarpus integrifolia lectin (Jacalin)
D1502.0001 Calmodulin
D1503.0100 Concanavalin A
D1504.0010 Crotalaria juncea lectin
D1505.0005 Phaseolus vulgaris lectin P
D1506.0010 Lens culinaris lectin
D1507.0010 Narcissus pseudonarcissus lectin
D1508.0005 Phaseolus vulgaris lectin E
D1509.0010 Pisum sativum lectin
D1510.0010 Triticum vulgaris lectin
D1511.0010 Vicia ervilia lectin
D1512.0002 Phaseolus vulgaris lectin L
D1513.0005 Galanthus nivalis lectin
D2000.0100 Phosphate buffered saline tablets (pH7.4 - 100mL)
D2001.0012 Phosphate buffered saline tablets (pH7.4 - 500mL)
D2002.0010 Phosphate buffered saline tablets (pH7.4 - 1L)
D2003.0100 PBS tablets (pH7.4) with Tween 20 (500mL)
D2003.0112 PBS tablets (pH7.4) with Tween 20 (100mL)
D2004.0010 PBS tablets (pH7.4) with Tween 20 (1L)
D2005.0100 Sodium chloride tablets (100mL)
D2006.0010 Sodium chloride tablets (1L)
D2007.0100 Borate buffered saline tablets (pH8.2)
D2008.0008 Carbonate-Bicarbonate buffer tablets (pH9.6)
D2010.0024 p-Nitrophenylphosphate (5mg)
D2011.0024 p-Nitrophenylphosphate (20mg)
D2012.0005 D(+)Glucose 20%
D2013.0505 EDTA buffer (p8.0; 500mL)
D2013.1005 EDTA buffer (pH8.0; 1L)
D2014.1005 MgCl2 (1M)
D2015.1005 Mg2SO4 (1M)
D2016.1005 10X Phosphate buffered saline powder (pH7.4)
D2017.1010 Phosphate buffered saline powder (pH7.4 - 10L)
D2017.1025 Phosphate buffered saline powder (pH7.4 - 25L)
D2017.1050 Phosphate buffered saline powder (pH7.4 - 50L)
D2017.1100 Phosphate buffered saline powder (pH7.4 - 100L)
D2018.1003 Potassium acetate powder (3M)
D2018.1005 Potassium acetate powder (5M)
D2019.1001 Potassium chloride (1M)
D2019.1003 Potassium chloride (3M)
D2020.0005 Saline sodium citrate buffer (20X - pH7.0)
D2020.2005 Saline sodium citrate buffer (2X - pH7.0)
D2021.1052 Sodium acetate buffer (pH5.2)
D2021.1070 Sodium acetate buffer (pH7.0)
D2022.1003 Sodium chloride powder (3M)
D2022.1005 Sodium chloride powder (5M)
D2023.1010 Sodium dodecylsulfate (10%)
D2023.1020 Sodium dodecylsulfate (20%)
D2024.1005 Sodium hydroxide (5M)
D2025.1065 Sodium phosphate buffer (pH6.5 - 1M)
D2025.1072 Sodium phosphate buffer (pH7.2 - 1M)
D2026.1074 Tris buffer (pH7.4)
D2026.1080 Tris buffer (pH8.0)
D2026.1083 Tris buffer (pH8.3)
D2027.1010 10X Tris buffered saline (pH8.0)
D2028.1001 Tris buffered saline (pH8.0)
D2029.0505 50X Tris-Acetate-EDTA buffer (pH8.3 - 500mL)
D2029.1005 50X Tris-Acetate-EDTA buffer (pH8.3 - 1L)
D2030.1001 Tris-Borate-EDTA buffer (pH8.3)
D2030.1005 5X Tris-Borate-EDTA buffer (pH8.3)
D2030.1010 10X Tris-Borate-EDTA buffer (pH8.3)
D2031.1010 10X Tris-EDTA buffer (pH7.4)
D2032.1010 Tris-Glycine buffer (pH8.3 - 1L)
D2032.5010 Tris-Glycine buffer (pH8.3 - 5L)
D2033.0010 PBS tablets w/o K (pH7.4 - 1L - 0.01M)
D2033.2010 PBS tablets w/o K (pH7.4 - 1L - 0.02M)
D2034.0100 PBS tablets (pH7.2 - 1L)
D2035.5005 Urea 5M
D2035.8005 Urea 8M
D2036.0050 Sodium dodecylsulfate (0.5g)
D2037.0010 TBS pH7.6
D2038.0010 TBS with Tween®20, pH7.6
D2039.0010 Buffered sodium citrate (3.2% - 0.109M)
D2040.0005 Buffered sodium citrate (3.8% - 0.109M)
D2041.1070 Sodium phosphate buffer (pH7.0 - 0.02M)
D2042.1065 Sodium phosphate buffer (pH6.5 - 0.1M)
D2042.1070 Sodium phosphate buffer (pH7.0 - 0.1M)
D2042.1074 Sodium phosphate buffer (pH7.4 - 0.1M)
Dysregulation and, in particular, overproduction of TNF have been implicated in a variety of human diseases- autoimmune diseases, insulin resistance, and cancer. Synonyms: TNF-alpha, Tumor necrosis factor ligand superfamily member 2, TNF-a, Cachectin, DIF, TNFA, TNFSF2."
I1071.0000 Vibration absorber (white)
I1071.0001 Vibration absorber (black/white)
I1071.0002 Vibration absorber (blue)
I1071.0003 Vibration absorber (green)
I2000.0001 1 Microplate shaker
I2000.0003 1 MTP Reader
I2001.0001 Cryobox with coding - yellow
I2001.0002 Cryobox with coding - blue
I2001.0003 Cryobox with coding - green
I2001.0004 Cryobox with coding - red
I2002.0001 Cryobox with coding - yellow
I2002.0002 Cryobox with coding - blue
I2002.0003 Cryobox with coding - green
I2002.0004 Cryobox with coding - red
I2003.0025 96-well PCR plates
I2004.0025 96-well PCR plates, coded
I2005.0001 Storage Box (0.2 mL PCR). Neon yellow.
I2005.0002 Storage Box (0.2 mL PCR). Neon blue
I2005.0003 Storage Box (0.2 mL PCR). Neon green
I2005.0004 Storage Box (0.2 mL PCR). Neon red
I2005.0005 Storage Box (0.2 mL PCR). Neon orange.
I2006.0001 Storage Box (card-board box). 133x133 mm. Yellow
I2006.0002 Storage Box (card-board box). 133x133 mm. Blue
I2006.0003 Storage Box (card-board box). 133x133 mm. Green
I2006.0004 Storage Box (card-board box). 133x133 mm. Red
I2006.0005 Storage Box (card-board box). 133x133 mm. White
I2006.0006 Card-board box with optimised waterproof coating. 133x133 mm. Yellow
I2006.0007 Card-board box with optimised waterproof coating. 133x133 mm. Blue
I2006.0008 Card-board box with optimised waterproof coating. 133x133 mm. Green
I2006.0009 Card-board box with optimised waterproof coating. 133x133 mm. Red
I2006.0010 Card-board box with optimised waterproof coating. 133x133 mm. White
I2007.0001 Storage Box (card-board box). 136x136 mm. Yellow
I2007.0002 Storage Box (card-board box). 136x136 mm. Blue
I2007.0003 Storage Box (card-board box). 136x136 mm. Green
I2007.0004 Storage Box (card-board box). 136x136 mm. Red
I2007.0005 Storage Box (card-board box). 136x136 mm. White
I2007.0006 Card-board box with optimised waterproof coating. 136x136 mm. Yellow
I2007.0007 Card-board box with optimised waterproof coating. 136x136 mm. Blue
I2007.0008 Card-board box with optimised waterproof coating. 136x136 mm. Green
I2007.0009 Card-board box with optimised waterproof coating. 136x136 mm. Red
I2007.0010 Card-board box with optimised waterproof coating. 136x136 mm. White
I2008.0001 Grid Divider (card-board - 10 x 10 grid - 30 mm)
I2008.0002 Grid Divider (card-board - 9 x 9 grid - 30 mm)
I2008.0003 Grid Divider (card-board - 10 x 10 grid - 25 mm)
I2008.0004 Grid Divider (card-board - 10 x 10 grid - 40 mm)
I2008.0005 Grid Divider (card-board - 10 x 10 grid - 65 mm)
I2009.0000 Freezer Box with coding (A1 - I9) - white
I2009.0001 Freezer Box with coding (A1 - I9) - yellow
I2009.0002 Freezer Box with coding (A1 - I9) - blue
I2009.0003 Freezer Box with coding (A1 - I9) - green
I2009.0004 Freezer Box with coding (A1 - I9) - red
I2009.0005 Freezer Box with coding (A1 - I9) - orange
I2009.0006 Freezer Box with coding (A1 - I9) - black
I2010.0025 96-well PCR plates, full skirted
I2011.0301 Flat 8 cap sealing strip.
I2011.0302 Domed 8 cap sealing strip.
I2012.0100 Sealing film for PCR plates.
I2013.0000 Freezer Box (7x7) without coding - white
I2013.0001 Freezer Box (7x7) without coding - yellow
I2013.0002 Freezer Box (7x7) without coding - blue
I2013.0003 Freezer Box (7x7) without coding - green
I2013.0004 Freezer Box (7x7) without coding - red
I2013.0005 Freezer Box (7x7) without coding - orange
I2014.0025 96-well PCR plates, semi skirted
I2015.0001 Freezer Box with attached lid (10 x 10). Yellow.
I2015.0002 Freezer Box with attached lid (10 x 10). Blue.
I2015.0003 Storage Box with attached lid (10 x 10). Green.
I2015.0004 Storage Box with attached lid (10 x 10). Red.
I2015.0005 Storage Box with attached lid (10 x 10). Orange.
I2016.0025 96-well PCR plates, full skirted, white
I2017.0025 96-well PCR plates, semi skirted, white
I2018.0000 Freezer Box without coding - white
I2018.0001 Freezer Box without coding - yellow
I2018.0002 Freezer Box without coding - blue
I2018.0003 Freezer Box without coding - green
I2018.0004 Freezer Box without coding - red
I2018.0005 Freezer Box without coding - orange
I2020.0500 Screw Cap Micro Tubes (0.5mL)
I2021.0500 Screw Cap Micro Tubes (1.5mL)
I2022.0500 Screw Cap Micro Tubes (2.0mL)
I2023.0500 Screw caps with O-ring (mixed colours)
I2024.0500 Screw caps with O-ring (Green)
I2025.0500 Screw caps with O-ring (Blue)
I2026.0500 Screw caps with O-ring (Red)
I2027.0500 Screw caps with O-ring (Orange)
I2028.0500 Screw caps with O-ring (Transparent)
I2029.0500 Screw caps with O-ring (Violet)
I2033.0500 Screw caps with O-ring (Yellow)
I2101.0100 0.5mL Dispenser tip
I2102.0100 1.25mL Dispenser tip
I2102.0800 Cryotubes 1.2 mL (sterile)
I2102.1001 Cryotubes 1.2 mL (non-sterile)
I2102.2000 Cryotubes 2.0 mL (sterile)
I2102.2001 Cryotubes 2.0 mL (non-sterile)
I2102.4000 Cryotubes 4.0 mL (sterile)
I2102.4001 Cryotubes 4.0 mL (non-sterile)
I2102.5000 Cryotubes 5.0 mL (sterile)
I2102.5001 Cryotubes 5.0 mL (non-sterile)
I2103.000X Colour code Inserts
I2103.0100 2.5mL Dispenser tip
I2104.0100 5.0mL Dispenser tip
I2105.0100 12.5mL Dispenser tip
I2106.0050 25mL Dispenser tip
I2107.0025 50mL Dispenser tip
I2108.0000 sterile Dispenser tips
I2109.0006 Tube-stand LS-6
I2109.0010 Tube-stand LS-10
I2110.0048 Tube-stand LS-48
I2110.0096 Tube-stand LS-96
I2200.0600 Conical centrifugation tubes (Falcon(TM) type) of 50mL
I2201.0500 Skirted centrifugation tubes (Falcon(TM) type) of 50mL
I2202.0750 Conical centrifugation tubes (Falcon(TM) type) of 15mL
I2203.0750 Sterile conical centrifugation tubes (Falcon(TM) type) of 15mL.
I2204.0320 Sterile, skirted centrifugation tubes (Falcon(TM) type) of 50mL
I2210.0100 Cell scrapers (24 cm)
I2211.0100 Cell scrapers (30 cm)
I2212.0360 Sterile, conical centrifugation tubes (Falcon(TM) type) of 50mL
I2213.1000 Pasteur pipets (3mL)
I2214.0360F Tissue culture flask (Filter)
I2214.0360V Tissue culture flask (Vent)
I2215.1000 Disposable serological pipet (1mL).
I2216.1000 Disposable serological pipet (2mL).
I2217.1000 Disposable serological pipet (5mL).
I2218.0800 Disposable serological pipet (10mL).
I2219.0600 Disposable serological pipet (25mL).
I2220.1015 Reaction tube (1.5mL). White
I2220.1020 Reaction tube (2.0mL).
I2221.1002 PCR reaction tubes (single tube, flat cap), 0.2 mL
I2221.1005 PCR reaction tubes (single tube, flat cap), 0.5 mL
I2221.1012 PCR reaction tubes (single tube, domed cap), 0.2 mL
I2224.0960 0.1 - 10µL pipet tips (non-sterile)
I2225.0960 0.1 - 10µL pipet tips (sterile)
I2226.0960 0.5 - 10µL pipet tips (non-sterile)
I2227.0960 0.1 - 20µL pipet tips (sterile)
I2228.0960 1 - 200µL pipet tips (non-sterile). Natural coloured
I2229.0960 1 - 200µL pipet tips (sterile). Natural coloured.
I2230.0960 1 - 200µL pipet tips (non-sterile). Yellow coloured.
I2231.0100F Cell culture flask (Filter)
I2231.0100V Cell culture flask (Vent)
I2232.0960 100 - 1000µL pipet tips (non-sterile). Natural coloured.
I2233.0960 100 - 1000µL pipet tips (sterile). Natural coloured.
I2234.0960 100 - 1000µL pipet tips (non-sterile). Blue coloured.
I2235.0036F Cell culture flask (Filter)
I2235.0036V Cell culture flask (Vent)
I2236.0960 Filter Tips in rack (0.1 - 10µL). Sterile.
I2236.5000 Filter Tips (0.1 - 10µL). Sterile.
I2237.0960 Filter Tips in rack (0.1 - 20µL). Sterile.
I2237.5000 Filter Tips (0.1 - 20µL). Sterile.
I2238.0960 Filter Tips in rack (1 - 50µL). Sterile.
I2238.5000 Filter Tips (1 - 50µL). Sterile.
I2239.0960 Filter Tips in rack (1 - 100µL). Sterile.
I2239.5000 Filter Tips (1 - 100µL). Sterile.
I2240.0960 Filter Tips in rack (1 - 200µL). Sterile.
I2240.5000 Filter Tips (1 - 200µL). Sterile.
I2241.0960 Filter Tips in rack (100 - 1000µL). Sterile.
I2241.5000 Filter Tips (100 - 1000µL). Sterile.
I2242.1620 PS Petri Dishes (d = 55 mm)
I2243.0480 PS Petri Dishes (d = 92 mm)
I2244.0900 Sterile cell culture petri dishes (D = 40mm; H = 11mm)
I2245.0840 Sterile cell culture petri dishes (d = 60 mm)
I2246.0240 Sterile cell culture petri dishes (d = 100 mm)
M3000.0100 LongMax PCR Kit (up to 20kb)
M3001.0250 Taq Polymerase S (high specificity)
M3002.0100 Pwo Polymerase
M3003.0100 ReproFast Polymerase
M3004.0250 Pfunds proof reading polymerase
M3005.0500 Tth Polymerase
M3006.0200 HotStart Taq with Antibody
M3007.0100 SuperHot Mastermix (2-times)
M3008.0050 DirectBlood Mastermix
M3009.020M HotStart Taq PCR Kit with dNTPs
M3010.0100 ProbeMasterMix (2X) High ROX
M3011.0100 GreenMasterMix (2X) Low ROX
M3012.0250 ReproHot Polymerase
M3013.0250 Tth Inorganic Pyrophosphatase Thermostable
M3014.0100 PCR Mastermix (2X)
M3015.4020 dNTP-Set (Na-salt) - 100 mM
M3016.0200 ready to use PCR dNTP-Mix (Na-salt) - 10 mM
M3017.1002 ready to use PCR dNTP-Mix (Na-salt) - 2 mM
M3018.0020 dATP solution
M3019.0020 dCTP solution
M3020.0020 dGTP solution
M3021.0020 dTTP solution
M3022.0020 dUTP solution
M3023.0100 GreenMasterMix (2X)
M3024.0810 Mineral Oil
M3025.0001 Bacterial Alkaline Phosphatase (BAP)
M3026.0500 T4 Polynucleotide Kinase
M3027.1010 T4 DNA-Ligase
M3028.0010 DNase I (EC 3.1.21.1)
M3029.0100 RedTaqMastermix(2X)
M3030.0100 ExactRun Polymerase
M3031.0100 GreenMasterMix UNG (2X)
M3033.0001 Calf Intestine Phosphatase (CIP) Grade I
M3034.0500 RNase Inhibitor
M3035.0001 Calf Intestine Phosphatase (CIP)
M3036.0100 Proteinase K powder (>30U/mg)
M3037.0001 Proteinase K solution (20mg/mL)
M3038.0125 Random-Primer N6
M3039.0150 Oligo dT20
M3041.0005 B-Enhancer solution
M3042.1010 M-MuLV
M3043.0250 Taq Polymerase E (high efficiency)
M3044.0050 Agarose LE
M3046.0025 Agarose Tiny
M3047.0025 Agarose Tiny HT
M3048.0010 Agarose Tiny LMH
M3049.0010 Agarose LM
M3050.0050 Agarose ME
M3051.0025 Agarose Mega
M3052.0100 GreenMasterMix (2X) High ROX
M3070.0200 WideRange GenLadder
M3071.0150 HighRange GenLadder
M3072.0050 GenLadder 50bp (ready-to-use)
M3073.0050 Lambda-DNA (undigested)
M3075.0050 Lambda-DNA - Hind III DNA Marker
M3076.0050 Lambda-DNA - BstE II DNA marker
M3077.0050 Phage T7 DNA
M3078.0050 pUC19 / MspI DNA marker
M3079.0050 Lambda DNA / Sty I marker
M3080.0050 pBR322 - Hae III DNA marker
M3081.0050 pUC19 (undigested vector)
M3082.0050 GenLadder 100bp
M3084.0050 GenLadder 1kb
M3085.1000 TAE buffer (10X) ready-to-use solution
M3087.0500 TAE buffer (50X) ready-to-use solution
M3088.1000 TBE buffer (10X) ready-to-use solution (MB-Grade)
M3090.0500 TE buffer (100X) Molecular Biology grade
M3091.0500 TE buffer (1X) Molecular Biology grade
M3092.0005 Bromophenol blue sodium salt
M3093.0010 Coomassie-brilliant blue R-250 (C.I. 42660)
M3094.0050 GenLadder 100 bp + 1.5 kbp (ready-to-use)
M3095.0500 TE buffer (100X)
M3096.0200 Uracil-DNA Glycosylase (UDG)
M3097.0500 Glycerol anhydrous Molecular biology grade
M3098.1000 TE buffer (1X)
M3099.0001 Bovine albumin acetylated, molecular biology grade
M3100.0001 Bovine albumin crystallized, free of fatty acid, free of globulin
M3101.0010 Bovine albumin for EIA and RIA
M3102.0025 Bovine albumin Fraction V (pH 5.2)
M3103.0010 Bovine albumin Fraction V (pH 7.0)
M3104.0010 Bovine albumin Fraction V very low endotoxin
M3105.0005 Ovalbumin
M3106.0010 Bovine albumin Microbiology grade
M3107.0005 Actinomycin D, p.A.
M3108.0001 Amphotericin B Powder
M3109.0050 Amphotericin B solution
M3110.0010 Ampicillin sodium salt, molecular biology grade
M3111.0005 Bacitracin powder, 70 000 U/g
M3112.0001 Bleomycin sulfate, lyophil. pure
M3113.0001 Carbenicillin disodium salt USP XXI, BP 88
M3114.0025 Chloramphenicol, analytical grade, min. 99%
M3115.0010 Chlortetracycline hydrochloride
M3116.0005 Erythromycin base, research grade,
M3117.0001 Geneticin disulfate (G418) Powder (min. 98% DC)
M3118.0020 Geneticin (G418), 50 mg/mL
M3119.0005 Blasticidin S hydrochloride
M3120.0025 Genistein
M3121.0001 Gentamycin sulfate powder, research grade
M3122.0050 Gentamycin sulfate, 10 mg/mL
M3123.0020 Gentamycin sulfate, 50 mg/mL
M3124.0001 Gramicidin, research grade
M3125.0001 Hygromycin B Powder
M3126.0020 Hygromycin B - 50mg/mL Solution
M3127.0001 Cefotaxime-Na-salt
M3128.0001 Ionomycin free acid
M3129.0010 Kanamycin sulfate (BP 88), 698 IU/mg
M3130.0050 Kanamycin sulfate 5 mg/mL
M3131.0050 Kanamycin sulfate 10 mg/mL
M3132.0050 Kanamycin sulfate 50 mg/mL
M3133.0001 Mithramycin A
M3134.0010 Mitomycin C, lyophil.
M3135.0050 Minocyclin, 0.5 mg/mL
M3136.0010 Neomycin sulfate Powder, research grade, min. 650 U/mg.
M3137.0100 Neomycin-sulfate Solution, 10 mg/mL
M3138.0005 Nystatin dihydrate, min. 4400 U/mg, research grade.
M3139.0010 Penicillin G potassium salt, research grade
M3140.0100 Penicillin/Streptomycin (100X)
M3141.0001 Polymyxin B sulfate ca. 7000 IU/mg
M3142.1010 TBE buffer (10X) ready-to-use solution in Cubitainer
M3143.0005 Puromycin dihydrochloride, research grade
M3144.0001 Rifampicin, research grade
M3145.0001 Spectinomycin dihydrochloride pentahydrate
M3146.0025 Streptomycin-sulfate powder, research grade, BP 88, min. 720 U/mg
M3148.0025 Tetracycline hydrochloride, research grade
M3149.0050 Tiamutin, 1mg/mL
M3150.0025 Valinomycin, research grade
M3151.0001 Vancomycin hydrochloride
M3152.0050 Polymyxin B sulphate ca. 10000 U/mL, solution
M3153.0010 Oxytetracycline hydrochloride
M3154.0005 Oligomycin A
M3155.0005 Oligomycin
M3156.0001 Ciprofloxacin
M3157.0025 Tylosin-tartrate (100x)
M3158.0005 3,3'5,5'-Tetramethylbenzidine (TMB)
M3159.0100 TMB ready-to-use solution
M3160.0005 Luminol (min. 95%)
M3161.0250 Tris-Glycin Buffer (10X)
M3162.0500 Tris-Glycin Buffer (5X)
M3163.1000 Tris-Glycin Buffer (1X)
M3164.0020 pMBL-T/A Cloning Kit
M3165.0250 Nonidet(R) P40
M3166.0025 Nonidet(R) P40 - Solution (10 %) peroxide-free
M3167.1000 Polyethyleneglycol 4000
M3168.1000 Polyethyleneglycol 6000
M3169.0100 Triton(R) X-100
M3170.0025 Triton(R) X-100 peroxide-free
M3171.0500 Tween(TM) 20
M3172.0025 Tween(TM) 20 - Solution (10 %) peroxide-free
M3173.0500 Tween(TM) 80, tested for use in tissue culture
M3174.0025 Tween(TM) 80 - Solution (10 %) peroxide-free
M3175.0010 Acridine orange (C.I. 46005)
M3176.0010 DAPI, molecular biology grade, min. 98%.
M3177.0250 Ovalbumin (crude)
M3178.0010 1 % Ethidium bromide solution
M3179.0010 0.07 % Ethidium bromide
M3180.0010 Orange G (C.I. 16230)
M3181.0010 HighPure Propidium iodide
M3182.0001 Brefeldin A
M3183.0025 Dextran sulfate 500 sodium salt, molecular biology grade
M3184.0025 Dextran sulfate 40 sodium salt, 50% stock solution
M3185.0250 DF Taq Polymerase (DNA-free)
M3186.0001 Salmon sperm DNA sodium salt
M3187.0001 Salmon sperm DNA (Na-salt) sonified.
M3188.1000 SSC buffer (20X)
M3189.0010 DEPC
M3190.0250 EDTA disodium salt dihydrate, Molecular biology grade
M3191.0500 EDTA disodium salt dihydrate p.A.
M3192.0500 EDTA tetrasodium salt dihydrate p.A.
M3193.0005 EGTA Molecular biology grade
M3194.0005 Phenylmethansulfonyl fluoride (PMSF), min. 99.5% pure.
M3195.0001 Thiazolyl Blue Tetrazolium Bromide
M3196.0001 BCIP, molecular biology grade,
M3197.0001 HighPure IPTG, dioxan free, (min. 99.5%).
M3198.0010 IPTG, dioxan free, molecular biology grade
M3199.0500 GelRed® in water (10000-time concentrate)
M3199.4000 GelRed® in water (3-time concentrate)
M3199.5000 GelRed® in water (10000-time concentrate)
M3200.0250 EDTA p.A.
M3201.0005 Cytosine
M3202.0001 Naphthol-AS-BI-phosphate
M3203.0001 Nitro Blue Tetrazolium Chloride, Molecular Biology grade
M3204.0001 X-Gal, Molecular biology grade (min. 99.0%)
M3205.0050 X-Glu, molecular biology grade
M3206.1000 TBE buffer (10X) ready-to-use solution in PE-bottle
M3207.0100 Cesium chloride (99.9 %), Molecular biology grade
M3208.0050 Cesium chloride (99.999 %), ultra pure
M3209.0010 Ficoll 400
M3210.0010 Acetyl-Coenzym A
M3212.0001 3,3'-Diaminobenzidine tetrahydrochloride
M3268.0500 Glycerol anhydrous p.A.
M3269.0025 Ammonium persulfate Molbio grade
M3270.0100 Ammonium persulfate BioChemica
M3271.0500 Ammonium sulfate Molecular biology grade
M3272.0500 Ammonium sulfate p.A.
M3273.0500 Boric acid Molecular biology grade, min. 99.8%
M3274.1000 Citric acid monohydrate p.A., min. 99%
M3275.0500 Citric acid trisodium salt dihydrate, p.A. min. 99.0%
M3277.0005 DTE, molecular biology grade
M3278.0005 DTT, Molecular biology grade
M3280.0500 Glycine, free of pyrogens, min. 99.8%
M3281.0100 Guanidine hydrochloride, Molecular biology grade
M3282.0100 Lithium chloride p.A.
M3283.0500 Magnesium chloride hexahydrate p.A.
M3284.0250 Magnesium chloride hexahydrate
M3290.0100 SDS, Molecular Biology grade, min. 99.5%
M3291.0250 SDS, research grade, min. 97%
M3292.0500 SDS, Molecular Biology grade, 20% stock solution
M3293.0025 Silver nitrate, Molecular biology grade
M3294.0500 Sodium acetate trihydrate, analytical grade
M3295.0025 TEMED
M3296.0250 Peptone from casein (acid hydrolysate)
M3297.0250 Peptone from casein (enzymatic digest)
M3298.0250 Peptone from casein (pancreatic digest)
M3299.0250 Peptone from gelatine
M3300.0250 Lactalbuminhydrolysate
M3301.0250 Peptone from meat (pepsic digest)
M3302.0250 Peptone from Soybean (enzymatic digest)
M3303.0250 Yeast extract Molbio Grade
M3304.0250 Peptone from Wheat (enzymatic digest)
M3305.0250 RedTaq (Taq-polymerase labeled with red pigment)
M3306.025M SuperHot Taq PCR Kit with dNTPs
M3307.0250 SuperHot Taq-Polymerase for qPCR
M3308.0005 DNA Loading buffer I
M3310.0500 HighPure Urea
M3311.0500 Urea powder for molecular biology (min. 99%)
M3312.0010 Xylene cyanol FF
M3313.1000 Taq-S PCR Kit with dNTPs
M3314.0025 Amido Black 10B
M3315.0250 5% SDS Solution
M3321.0005 DNA Loading buffer II
M3324.0100 Hybridisation solution
M3325.0001 Rose-Gal - Red-Gal molecular biology grade
M3326.0005 Chromomycin 3A
M3327.1000 Taq-E PCR Kit with dNTPs
M3328.0050 GenLadder 250bp - 10kb (ready-to-use)
M3329.0250 Mycophenolic Acid
M3337.0100 Urea for 2D-gel electrophoresis (min. 99.5%)
M3338.0005 4-Chloro-1-Naphtol (min. 99.0% HPLC)
M3339.0100 4-Chloro-1-Naphtol (0.48 mM solution)
M3340.0050 GenLadder 100 bp + 1.5 kbp
M3349.0010 Ponceau S (C.I. 27195)
M3350.0100 Ponceau S Solution
M3351.0100 Methylen Blue Solution (0.1%)
M3352.0010 Methylen Blue DNA-staining solution
M3356.0010 Agarose ISO
M3358.0001 Ionomycin Ca-salt
M3359.0010 Methylen Blue (C.I. 52015)
M3360.0005 Patulin HighPure
M3361.0005 Tunicamycin, min. 95%
M3363.0005 Methyl Green (C.I. 42590)
M3364.0001 Diisopropylfluorophosphate
M3365.0050 Anisomycin, min. 99.0%
M3366.0005 Antipain x 2HCl
M3369.0001 D-Cycloserine, high pure
M3370.0010 Neutral Red (C.I. 50040)
M3371.0001 Cresol Red
M3373.0250 custom made 10X PCR Buffer
M3374.0001 TPCK
M3375.0001 TLCK
M3397.0025 Fuchsin basic pure (C.I. 42510)
M3398.0025 Fuchsin acid pure (C.I. 42685)
M3399.0005 Fast Green FCF (C.I. 42053)
M3400.0100 dTTP Powder, ca. 99.0%
M3401.0100 dCTP Powder, 96.0% to 98.0%
M3402.0100 dATP Powder, min. 97.0%
M3403.0100 dGTP Powder, min. 97.0%
M3404.0100 dUTP Powder, min. 96.0%
M3405.1000 TBE buffer (5X) ready-to-use solution in PE-bottle
M3406.1010 TBE buffer (5X) ready-to-use solution in Cubitainer
M3407.1000 TBE buffer (5X) ready-to-use solution (MB-Grade)
M3423.0100 AZT triphosphate (min. 96%), 100 mM
M3424.0050 d4T triphosphate (min. 96%)
M3425.0100 BUdR triphosphate (min. 96%)
M3426.0040 Flu-12-dUTP (1 mg/mL)
M3427.0040 Tamra-dUTP (1 mg/mL)
M3428.0100 Biotin-11-dUTP
M3429.0250 Phleomycin Powder
M3431.0030 Alligator Ligation Kit with competent cells
M3434.0010 Chemical competent cells (>10E8)
M3436.0000 dAMP
M3437.0000 dCMP
M3438.0000 dGMP
M3439.0000 dTMP
M3440.0050 Biotin-4-dUTP
M3441.0100 N-Cetyl-N,N,N-trimethylammoniumbromid
M3445.0005 Lincomycin Hydrochloride
M3446.0001 Zeocin™
M3447.0005 Bestatine Hydrochloride
M3448.0010 Amoxycillin
M3449.0002 Amoxycillin Sodium / Potassium Clavulanate
M3450.0005 Apramycin Sulfate
M3451.0200 2'-Deoxy-2'-aminouridine
M3452.0200 5'-DMTr-Deoxy-2'-TFA-amidouridine
M3453.0015 10X PCR Buffer S incomplete
M3454.0015 10X PCR Buffer S complete
M3455.0015 10X PCR Buffer E incomplete
M3456.0015 10X PCR Buffer E complete
M3457.0010 QuickClone Kit
M6001.0100 Agar for Bacteriology
M6002.0100 Agar Bacteriology grade, highly purified
M6003.0100 Agar Molecular biology grade
M6004.0250 Agar Plant tissue culture grade
M6005.0500 Agar-Agar Food grade
M6006.0500 YT-Broth (2X)
M6008.0100 LB-Agar - Powder
M6009.0100 LB-Medium - Powder
M6009.0500 LB-Medium - Powder
M6016.0500 Ammonium acetate Molecular biology grade
M6017.0500 Ammonium acetate p.A. BioChemica
M6017.5000 Ammonium acetate p.A BioChemica
M6018.0500 Ammonium chloride p.A. BioChemica
M6019.1000 Boric acid buffer grade
M6021.1000 Boric acid BioChemica
M6022.1000 Citric acid monohydrate buffer grade
M6023.1000 Diethylene glycol
M6024.0500 Sodium dihydrogen phosphate dihydrate (min. 99.0%)
M6025.1000 di-Sodium hydrogen phosphate dodecahydrate, BioChemica
M6026.0500 di-Sodium hydrogen phosphate dihydrate (min. 99.0%)
M6027.0500 di-Sodium hydrogen phosphate, anhydrous (min. 99.0%)
M6028.1000 Ethylene glycol
M6030.0100 DL-Malic acid, BioChemica
M6031.0005 DTT, BioChemica
M6032.0001 Guanidine hydrochloride, pure
M6043.0500 Glycerol 87 % Molecular biology grade
M6044.0500 Glycerol 87 % p.A.
M6045.0005 Glycogen
M6046.0250 Guanidine hydrochloride, BioChemica
M6047.0250 Guanidine hydrochloride, ultrapure
M6049.0100 Guanidine thiocyanate - 4M Solution.
M6050.0100 Guanidine thiocyanate - 6M Solution.
M6051.0100 Guanidine thiocyanate Molecular biology grade
M6052.0250 Potassium chloride, cell culture grade
M6053.0100 Guanidine hydrochloride - 4M Solution.
M6054.0100 Guanidine hydrochloride - 8M Solution.
M6055.0001 NAD
M6056.0001 NADH Na-salt
M6057.0001 NADP Na-salt
M6058.0001 NADPH Na4-salt, min. 96%
M6059.1000 Polyethyleneglycol 400
M6060.1000 Polyethyleneglycol 1000
M6061.0500 Polyethyleneglycol 8000
M6062.0500 Potassium acetate analytical grade
M6063.0500 Potassium chloride Molecular biology grade
M6064.0500 Potassium chloride, analytical grade
M6065.0500 Potassium dihydrogen phosphate Molecular biology grade
M6066.0500 Potassium dihydrogen phosphate, analytical grade
M6067.0500 Potassium sulfate, p.A.
M6070.0025 Silver nitrate, analytical grade, min. 99.8%
M6071.0050 Sodium azide pure
M6072.0500 Sodium carbonate anhydrous, p.A.
M6073.0500 Sodium chloride Molecular biology grade
M6074.1000 Sodium chloride p.A.
M6075.0500 Sodium dihydrogen phosphate dihydrate, BioChemica
M6076.1000 Sodium dihydrogen phosphate monohydrate, BioChemica
M6077.0001 Trypsin from bovine pancreas
M6080.0250 Cleaning solution
M6081.0500 Sterile water for cell culture in bottles
M6081.1001 Sterile water for cell culture in plastik bag with tap
M6083.0100 L-Alanine BioChemica
M6084.0100 L-Alanine Cell culture grade
M6085.0100 L-Arginine base BioChemica
M6086.0100 L-Arginine base Cell culture grade
M6087.0100 L-Arginine hydrochloride BioChemica
M6088.0100 L-Arginine hydrochloride Cell culture grade
M6089.0100 L-Asparagine monohydrate BioChemica
M6090.0100 L-Asparagine monohydrate Cell culture grade
M6091.0250 L-Aspartic acid BioChemica
M6092.0250 L-Aspartic acid Cell culture grade
M6093.0010 L-Carnitine
M6094.0050 L-Cysteine base BioChemica
M6096.0050 L-Cysteine base Cell culture grade
M6097.0050 L-Cysteine hydrochloride monohydrate Cell culture grade
M6098.0050 L-Cystine BioChemica
M6099.0050 L-Cystine Cell culture grade
M6100.0010 Leupeptin hemisulfate
M6101.0500 L-Glutamic acid BioChemica
M6102.0250 L-Glutamic acid Cell culture grade
M6103.0100 L-Glutamine BioChemica
M6104.0100 L-Glutamine Cell culture grade
M6105.0001 L-Glutathione oxidized
M6106.0005 L-Glutathione reduced
M6107.0050 L-Histidine base BioChemica
M6108.0050 L-Histidine base Cell culture grade
M6109.0050 L-Histidine hydrochloride monohydrate Cell culture grade
M6110.0025 L-Hydroxyproline BioChemica
M6111.0025 L-Hydroxyproline Cell culture grade
M6112.0025 L-Isoleucine BioChemica
M6113.0025 L-Isoleucine Cell culture grade
M6114.0100 L-Leucine BioChemica
M6115.0100 L-Leucine Cell culture grade
M6116.0025 L-Lysine monohydrate BioChemica
M6117.0025 L-Lysine monohydrate Cell culture grade
M6118.0250 L-Lysine monohydrochloride Cell culture grade
M6119.0100 L-Methionine BioChemica
M6120.0050 L-Methionine Cell culture grade
M6121.0050 L-Ornithine hydrochloride BioChemica
M6122.0050 L-Ornithine hydrochloride Cell culture grade
M6123.0100 L-Phenylalanine BioChemica
M6124.0100 L-Phenylalanine Cell culture grade
M6125.0025 L-Proline BioChemica
M6126.0025 L-Proline Cell culture grade
M6127.0100 L-Serine BioChemica
M6128.0025 L-Serine Cell culture grade
M6129.0025 L-Threonine BioChemica
M6130.0025 L-Threonine Cell culture grade
M6131.0025 L-Tryptophan BioChemica
M6132.0025 L-Tryptophan Cell culture grade
M6133.0100 L-Tyrosine BioChemica
M6134.0025 L-Tyrosine Cell culture grade
M6135.0100 L-Valine BioChemica
M6136.0025 L-Valine Cell culture grade
M6138.10xx Blossom Latex Aloe Vera Plus
M6139.10xx Latex Superior with mint
M6140.10xx Blossom Aloe Vera Nitril
M6141.10xx Pretex Vinyl Transparent
M6142.005L Prima Duo
M6143.10xx Prima Plus Blau
M6144.10xx Prima Plus Natur
M6146.10xx Alfatex Natur
M6147.10xx Alfatex Blau
M6148.10xx Alfatex Blau 30
M6149.100L Baumwoll Strickhandschuh.
M6150.100L Gummihandschuh
M6151.0050 L-Cysteine hydrochloride monohydrate BioChemica
M6152.0050 L-Histidine hydrochloride monohydrate BioChemica
M6153.0250 L-Lysine monohydrochloride BioChemica
M6154.10xx Pretex Vinyl Natur
M6160.0500 L-Glutamic acid sodium salt
M6161.0101 Protective Mask Rob (FFP1)
M6161.0102 Protective Mask Rob (FFP2)
M6161.0103 Protective Mask Rob (FFP3)
M6161.2001 Protective Mask Rob (FFP1)
M6161.2002 Protective Mask Rob (FFP2)
M6161.2003 Protective Mask Rob (FFP3)
M6162.0001 GSH-OEt
M6163.0500 Tris-Glycin Buffer (1X)
M6165.0201 Protective Mask Kim (FPP1)
M6165.0202 Protective Mask Kim (FPP2)
M6165.0203 Protective Mask Kim (FPP3)
M6165.4001 Protective Mask Kim (FPP1)
M6165.4002 Protective Mask Kim (FPP2)
M6165.4003 Protective Mask Kim (FPP3)
M6166..0100 Face Mask
M6167.0050 Dust Mask
M6200.0100 CAPS buffer grade
M6201.0005 CHAPS for 2D-gel electrophoresis
M6202.0001 CHAPSO > 99.0% (HPLC)
M6203.0010 CHES, min. 99.0%
M6204.0100 HEPES, tissue culture grade
M6205.0100 HEPES, molecular biology grade
M6206.0050 MES anhydrous, research grade
M6207.0050 MES monohydrate buffer grade
M6208.0100 MOPS , ultra pure for molecular biology use, min. 99.5%
M6209.0100 PIPES, ultrapure
M6210.0500 Tris buffer grade, min. 99.5%.
M6211.0250 TRISxHCl p.A.
M6212.0250 TRISxHCl
M6213.0250 Calcium lactate pentahydrate
M6214.0100 Sodium gluconate
M6250.0250 4-Nitrophenyl a-L-fucopyranoside Purity >99%
M6251.0005 4-Nitrophenyl a-D-manopyranoside Purity >99%
M6252.0001 4-Nitrophenyl b-D-xylopyranoside Purity >99%
M6253.0005 Fluorescein-dilaurate
M6254.0050 4-Nitrophenyl-2-acetamido-2-deoxy-a-D-galactopyranoside (min. 99.0% HPLC)
M6255.0050 2-Nitrophenyl-2-acetamido-2-deoxy-a-D-galactopyranoside (min. 99.0% HPLC)
M6256.0001 4-Nitrophenyl-2-acetamido-2-deoxy-b-D-glucopyranoside (min. 99.0% HPLC)
M6257.0100 MOPS buffer grade, min. 99.5%
M6258.0005 CHAPS buffer grade
M6321.0500 DMF, Molecular biology grade (min. 99.5% GC)
M6322.0500 DMF, p. A., (min. 99.5% GC)
M6323.0100 DMSO, Cell culture grade
M6324.0100 DMSO, Molecular biology grade
M6325.0100 DMSO, p. A.
M6326.1010 Ethanol 70 % BioChemica, denatured with ketones
M6331.0250 Isoamyl alcohol p.a. BioChemica
M6332.0500 Methanol dried, p.A. (min. 99.8% GC)
M6333.1000 Methanol p.A. (min. 99.8% GC)
M6334.0500 Acetic Acid (100%)
M6337.1000 2-Propanol p.A. (min. 99.7% GC)
M6340.0100 Eli-Pure
M6341.0500 Ethanol absolute, BioChemica
M6342.2500 Water for HPLC Chromatography
M6343.0500 Water for DNA Analysis
M6346.1000 Methanol HPLC-grade (min. 99.9% GC)
M6347.0100 Bis-Tris, analytical grade
M6348.0250 Potassium dihydrogen phosphate, cell culture grade
M6350.1000 Ethanol HPLC grade
M6352.0250 Ethanol 70 % p.A.
M6353.0250 Ethanol 96%, p.A.
M6359.0010 Pepstatin A
M6360.0100 AEBSF Hydrochloride
M6361.0010 Aprotinin from bovine lung
M6362.0100 Bicine buffer grade
M6363.0100 Cetylpyridiniumbromide
M6364.0100 Cetylpyridiniumchloride - Monohydrate
M6366.0500 Sodium hydroxide Pellets (p.a.)
M6367.0100 Lithium acetate dihydrate (min. 99%)
M6368.0100 Calcium chloride hexahydrate
M6369.1000 Sodium carbonate decahydrate p.A.
M6370.0100 HEPES, buffer grade
M6371.0025 MOPSO buffer grade, min. 99.0%
M6371.0500 Sodium sulfate, anhydrous (min. 99.0%)
M6372.0025 Sodium Molybdate Dihydrate (p.A.)
M6373.0250 Sodium Thiosulphate Pentahydrate (p.A.)
M6374.06xx Sterile Operationshandschuhe (rechts/links)
M6377.06xx Sterile Neopren Operationshandschuhe (rechts/links)
M6378.0025 BES (buffer quality)
M6379.25xx Sterile Untersuchungshandschuhe (rechts/links)
M6380.24xx Sterile CoPolymer Einmalhandschuhe
M6382.0250 Salicylic acid sodium salt, p.A.
M6383.0001 rec. Aprotinin
M6384.0010 rec. Human Serum Albumin (rHSA)
P2001.0000 Library construction
P2002.0002 Cloning of PCR product
P2003.0001 Verification sequencing (< 300 bp)
P2003.0002 Verification sequencing (> 300 bp)
P2005.0001 Subcloning (sticky end, < 2000 bp)
P2005.0002 Subcloning (blunt end, < 2000 bp)
P2005.0003 Subcloning (difficult enzymes or fragments > 2000 bp)
P2007.0000 Synthetic genes
P2008.0000 cDNA cloning
P2009.0010 Plasmid preparation (up to 10 µg)
P2009.0100 Plasmid preparation (up to 100 µg)
P2009.0500 Plasmid preparation (up to 500 µg)
P2009.1010 Plasmid preparation (up to 10 mg)
P2010.0000 Transformation of plasmid-DNA
P2011.0000 Protein Expression (fermentor)
P2011.0003 Protein Expression Screening (E.coli).
P2011.1000 Protein Expression (flask)
P2012.0000 in vitro Mutagenesis
P2013.0000 Concentration of inclusion bodies
P2014.0000 Cold osmotic shock
P2017.0000 Construction of recombinant Baculo virus
P2018.0100 Generation of high titer stock (100 mL)
P2018.0500 Generation of high titer stock (500 mL)
P2018.1000 Generation of high titer stock (1 L)
P2019.0000 MOI Assay of protein production
P2020.0500 Production of proteins from rec. Baculo-viruses (500ml)
P2020.1000 Production of proteins from rec. Baculo-viruses (1 L)
P2020.1020 Production of proteins from rec. Baculo-viruses (20 L)
P2020.5000 Production of proteins from rec. Baculo-viruses (5 L)
P2021.1000 Affinity Protein Purification (1 L flask)
P2021.5000 Affinity Protein Purification (fermentor)
P2025.0010 Transient protein expression in insect cells
P2040.0005 N-terminal biotinylation of Protein (5 mg)
P2040.0010 N-terminal biotinylation of Protein (10 mg)
P2044.0002 Stability check
P2045.0005 Production of adherent cells
P2045.0012 Protein purification by IEF electrophoresis (12 cm)
P2045.0025 Protein purification by IEF electrophoresis (25 cm)
P2045.0050 Production of adherent cells
P2046.0010 Cell cultivation in spinner flasks
P2047.0000 Automated Edman degradation of protein.
P2047.0001 Cell production and cell processing
P2048.0000 Subsequent Degradation steps
P2049.0000 Chemical or enzymatic cleavage in solution
P2050.0000 Proteolytic cleavage
P2051.0000 Fractionation of peptides by HPLC
P2052.0000 N-terminal protein sequencing service
P2053.0000 Insuffient sample
P2054.0000 SDS-Gel electrophoresis
P2055.0000 2D Gel electrophoresis
P2057.0000 Protein purification by SDS-gel electrophoresis
P2091.1030 Peptide synthesis for screening (TIP method)
P2096.0000 Peptide Antigen
P2097.0000 Protein Antigen
P2119.0500 Peptide synthesis for screening
P2120.0000 Peptide Synthesis Trial
P2122.5502 Immunograde peptide (2 mg, min. 55% pure)
P2122.5505 Immunograde peptide (5 mg, min. 55% pure)
P2122.5510 Immunograde peptide (10 mg, min. 55% pure)
P2122.5520 Immunograde peptide (20 mg, min. 55% pure)
P2122.7002 High grade peptide (2 mg, min. 70% pure)
P2122.7005 High grade peptide (5 mg, min. 70% pure)
P2122.7010 High grade peptide (10 mg, min. 70% pure)
P2122.7020 High grade peptide (20 mg, min. 70% pure)
P2122.8002 High grade peptide (2 mg, min. 80% pure)
P2122.8005 High grade peptide (5 mg, min. 80% pure)
P2122.8010 High grade peptide (10 mg, min. 80% pure)
P2122.8020 High grade peptide (20 mg, min. 80% pure)
P2122.9502 High grade peptide (2 mg, min. 95% pure)
P2122.9505 High grade peptide (5 mg, min. 95% pure)
P2122.9510 High grade peptide (10 mg, min. 95% pure)
P2122.9520 High grade peptide (20 mg, min. 95% pure)
P2130.C000 C-terminal Biotin modification of peptide
P2130.N000 N-terminal Biotin modification of peptide
P2131.C000 C-terminal Fluorescein modification of peptide
P2131.N000 N-terminal Fluorescein modification of peptide
P2132.C000 Cyclisation of peptide
P2133.P000 Serin-phosphorylation at peptide
P2134.P000 Tyrosin-phosphorylation at peptide
P2135.P000 Threonin-phosphorylation at peptide
P2136.S000 Serin-sulfurylation at peptide
P2137.S000 Tyrosin-sulfurylation at peptide
P2138.S000 Threonin-sulfurylation at peptide
P2139.0000 MALDI-TOF Set-up
P2140.0000 MALDI-TOF peptide mapping
P2141.0000 Proteinidentification by ESI-MS/MS
P2142.I000 Isotope labelling of peptide
P2144.0000 Cloning of synthetic DNA
P2145.0001 Amino Acid Analysis of given Sample (total hydrolysis)
P2145.0002 Amino Acid Analysis of given Sample (without total hydrolysis)
P2145.0003 Amino Acid Analysis from animal food
P2145.0004 Amino Acid Analysis from physiological sample
P2200.0001 Pam3Cys-SKKKK
P2201.0001 Pam3Cys-SKKKK (Aca-Aca-Biotin)
P2202.0001 R-Pam3Cys-SKKKK
P2203.0001 Pam3Cys-SKKKK (Aca-Aca-Fluorescein)
P2204.0001 S-Pam3Cys-SKKKK
P2205.0001 Pam3Cys-SKKKK (Aca-Aca-Rhodamine)
P2206.0001 Pam2Cys-SKKKK
P2207.0001 Pam2Cys-SKKKK(Aca-Aca-Biotin)
P2208.0001 R-Pam2Cys-SKKKK
P2209.0001 Pam2Cys-SKKKK(Aca-Aca-Fluorescein)
P2210.0001 S-Pam2Cys-SKKKK
P2211.0001 Pam2Cys-SKKKK(Aca-Aca-Rhodamine)
P2212.0001 FSL-1
P2213.0001 R-FSL-1
P2214.0001 S-FSL-1
P2215.0001 FSL-1-Biotin
P2216.0001 FSL-1-Fluorescein
P2217.0001 FSL-1-Rhodamine
P2218.0001 Pam2Cys-SKKKK-FLAG-tag
P2219.0001 FSL-1-FLAG-tag
P2221.0002 FSL-1 Ala-scan
P2223.0001 Pam-Dhc-SKKKK
P2224.0001 Pam-Dhc-GDPKHPKSF
P2225.0001 PamCSKKKK
P2226.0001 PamCGDPKHPKSF
P2227.0001 Dhc-SKKKK
P2228.0001 Dhc-GDPKHPKSF
P2229.0001 SKKKK
P2230.0001 GDPKHPKSF
P2231.0001 Pam3Cys-SKKKK-FLAG-tag
P2232.0001 PHC-SKKKK
P2233.0001 PHC-SKKKK(Biotin-Aca-Aca)
P2234.0001 Pam3CysSSNAKIDQLSSDVQT
P2235.0001 Pam3CysSSNKSTTGSGETTTA
P2236.0001 Pam3CysSSTKPVSQDTSPKPA
P2237.0001 Pam3CysSSGSKPSGGPLPDAK
P2238.0001 Pam3CysSSGNKSAPSSSASSS
P2239.0001 Pam3CysGSHQMKSEGHANMQL
P2240.0001 Pam3CysSSSNNDAAGNGAAQT
P2241.0001 Pam3CysKQNVSSLDEKNSVSV
P2242.0001 Pam3CysNNSGKDGNTSANSAD
P2243.0001 Pam3CysNNGGPELKSDEVAKS
P2244.0001 Pam3CysSQEPAAPAAEATPAG
P2245.0001 Pam3CysSSSKSSDSSAPKAYG
P2246.0001 Pam3CysAQEKEAKSELDYDQT
P2247.0001 Amyloid-? (1-42) human
P2248.0001 Amyloid-? (1-42) human (HCl-salt)
P2249.0001 Amyloid-? (1-40) human
P2250.0001 Amyloid-? (1-40) human (HCl-salt)
P2251.0001 Control peptide Amyloid-? (42-1) human
P2252.0001 Control peptide Amyloid-? (40-1) human
P2253.0001 Biotinylated Amyloid-? (1-42) human
P2254.0001 Biotinylated Amyloid-? (1-40) human
P2255.7005 KLVFF (70%)
P2255.9501 KLVFF (95%)
P2256.7005 Ac-KLVFF-NH2 (70%)
P2256.9501 Ac-KLVFF-NH2 (95%)
P2257.7005 RIIGL (70%)
P2257.9501 RIIGL (95%)
P2258.7005 DWGKGGRWRLWPGASGKTEA (70%)
P2258.9501 DWGKGGRWRLWPGASGKTEA (95%)
P2259.7005 PGRSPFTGKKLFNQEFSQDQ (70%)
P2259.9501 PGRSPFTGKKLFNQEFSQDQ (95%)
P2260.9501 qshyrhispaqv (D-amino acids)
P2261.7005 FYLKVPSSLHHHHGRDKLVFFHHHH (70%)
P2261.9501 FYLKVPSSLHHHHGRDKLVFFHHHH (95%)
P2262.7005 NYSKMIFSHHHH (70%)
P2262.9501 NYSKMIFSHHHH (95%)
P2263.7005 HNHKLVFFHHQH (70%)
P2263.9501 HNHKLVFFHHQH (95%)
P2264.7005 MAQTFWLSIQGKTLYWQIRIYAID (70%)
P2264.9501 MAQTFWLSIQGKTLYWQIRIYAID (95%)
P2265.7005 MOG (35-55) rat/mouse
P2266.7005 MOG (35-55) human
P2267.7005 MOG (92-106)
P2268.7005 MOG (97-108)
P2269.7005 MOG (183-197)
P2270.7005 MOG (183-191)
P2271.7005 MBP (1-11) human
P2272.7005 MBP (54-72) human
P2273.7005 PLP (139-151)
P2274.7005 PLP (178-191)
P2275.7005 Ova (257-264)
P2276.7005 Influenza A NP (366-374)
P2277.7005 Influenza A matrix protein (58-66)
P2278.7005 HIV-1 p17 Gag (77-85)
P2279.7005 HCV-NS5b
P2280.7005 LCMV GP (33-41)
P2281.7005 Melan-A / MART-1 (27 - 35)
P2282.7005 MAGE-3 antigen (271-279)
P2283.7005 Ova (323-339)
P2284.7005 PADRE
P2285.7005 PADRE promiscuous
Q5375.0050 Blood/Genomic-DNA Purification Mini Prep Kit
QEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLV SLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE."
RF0009-10 rHu Activin A
RF001-1 rHuTGF-b2
RF0010-10
RF0012 Rabbit anti-human TFPI-2 antibody
RF0013 Rabbit anti-human Interferon a-2a antibody
RF0014 Rabbit anti-HGH antibody
RF0015 Rabbit anti-human TGF-ß2 antibody
RF0016 Rabbit anti-human Activin A antibody
RF0017 Rabbit anti-human BMP-7 antibody
RF0018 Rabbit anti-human TGF-ß3 antibody
RF0019-25 rHuLXR
RF002-1 rHuTGF-b3
RF0020 Rabbit anti-human LXR-ß antibody
RF0022 Rabbit anti-human Myostatin antibody
RF0026-10 rHu BMP-7
RF0027-5 rHu BMP-7 Active
RF003-1 rHuTGF-b2 Active
RF004-1 rHuTGF-b3 Active
RF007-1 rHuTFPI-2 Domain 1 Active
S3210.1000 D(+)-Sucrose, BioChemica
S3211.0500 D(+)-Sucrose, Molecular biology grade.
S4000.0001 Fe-Arthrobactin
S4001.0001 Fe-Aerobactin
S4002.0001 Coprogen
S4003.0001 Fusigen
S4004.0001 Ferrioxamine E
S4005.0001 Ferrioxamine G
S4006.0001 Fe-Rhodotorulic acid
S4007.0001 Ferrichrome
S4008.0001 Ferrichrome A
S4009.0001 Ferrichrysin
S4010.0001 Ferricrocin
S4011.0001 Ferrirhodin
S4012.0001 Ferrirubin
S4013.0001 Ornibactin (mixture)
S4014.0001 Ornibactin C6
S4015.0001 Fe-Rhizoferrin
S4016.0001 Fe-Schizokinen
S4018.0001 Desferri-Arthrobactin
S4019.0001 Aerobactin (Fe-free)
S4020.0001 Desferricoprogen
S4021.0001 Desferrifusigen
S4022.0001 Desferrioxamine E
S4023.0001 Desferrioxamine G
S4024.0001 Rhodotorulic acid (Fe-free)
S4025.0001 Desferrichrome
S4026.0001 Desferrichrome A
S4027.0001 Desferricrocin
S4028.0001 Desferrirhodin
S4029.0001 Desferrirubin
S4030.0001 Desferriornibactins (C4, C6, C8)
S4031.0001 Desferriornibactin C6
S4032.0001 Rhizoferrin (Fe-free)
S4033.0001 Schizokinen (Fe-free)
S4034.0001 Desferritriacetylfusarinine C
S4035.0001 Enterobactin (Fe-form)
S4036.0001 Fe-Salmochelin S4
S4037.0001 Fe-Yersiniabactin
S4038.0001 Enterobactin (Fe-free)
S4039.0001 Linear Trimer (Fe-free)
S4040.0001 Linear Dimer (Fe-free)
S4041.0001 DHBS monomer (Fe-free)
S4042.0001 Salmochelin S4 (Fe-free)
S4043.0001 Yersiniabactin (Fe-free)
S4044.0001 Albomycin (HPLC pure)
S4045.0001 HPLC-Cal. Kit Enterobactin
S4046.0001 HPLC-Cal. Kit Salmochelins
S4047.0001 HPLC-Cal. Kit Ferrioxamines
S4048.0001 HPLC-Cal. Kit Ferrichromes
S4049.0001 HPLC-Cal. Kit Coprogens
S4050.0001 Pyoverdine P. fluorescens (Fe-free)
S4052.0001 Pyoverdine P. aeruginosa (Fe-free)
S4055.0001 Pyoverdine P. putida (Fe-free)
S4057.0001 Pyoverdine P. tolaasii (Fe-free)
S4058.0001 Desferrichrysin
S4059.0001 Vibriobactin (Fe-free)
S4060.0001 Fe-Vibriobactin
S4061.0001 Triacetylfusarinine C
S4062.0001 Pyoverdine P. fluorescens
S4064.0001 Pyoverdine P. aeruginosa
S4067.0001 Pyoverdine P. putida
S4069.0001 Pyoverdine P. tolaasii
S5000.0250 2-Acetamido-2-deoxy-D-glucose >99.8% (HPLC)
S5001.0001 2-Acetamido-2-deoxy-ß-D-glucopyranosylamin >95.0% (TLC)
S5002.0001 2-Acetamido-2-deoxy-D-mannose monohydrate (Glc >99.9%)
S5003.0005 2-Acetamido-1,3,4,6-tetra-O-acetyl-2-deoxy-ß-D-gluco­pyranose Purity >99% (HPLC)
S5004.0001 2-Acetamido-3,4,6-tri-O-acetyl-2-deoxy-ß-D-gluco­pyranosyl azide Purity >99% (HPLC)
S5005.0005 2-Acetamido-3,4,6-tri-O-acetyl-2-deoxy-a-D-gluco­pyranosyl chlorid Purity >99% (HPLC)
S5006.0001 2-Amino-2-deoxy-1,3,4,6-tetra-O-acetyl-a-D-gluco­pyranose HCl Purity >99% (HPLC)
S5007.0001 Allyl 2-acetamido-2-deoxy-a-D-glucopyranoside Purity > 99% (TLC)
S5008.0001 Allyl 2-acetamido-2-deoxy-ß-D-glucopyranoside Purity > 99% (TLC)
S5008.0005 Allyl 2-acetamido-2-deoxy-ß-D-glucopyranoside Purity > 99% (TLC)
S5009.0001 Allyl a-D-galactopyranoside Purity > 99% (TLC)
S5010.0001 Allyl a-D-glucopyranoside Purity > 99% (TLC)
S5011.0001 Allyl ß-D-glucopyranoside Purity > 99% (TLC)
S5012.0001 Allyl 2,3,4-tri-O-benzyl-a-D-glucopyranoside Purity (TLC): one spot
S5013.0001 1-Amino-1-deoxy-ß-D-galactose TLC: one spot, Purity >96% (HPLC)
S5014.0001 1,6-Anhydro-ß-D-galactopyranose Purity >99% (HPLC)
S5015.0005 1,6-Anhydro-ß-D-glucopyranose Purity >99% (HPLC)
S5016.0001 1,6:3,4-Dianhydro-2-O-tosyl-ß-D-galactopyranose Purity 99% (HPLC)
S5017.0100 D-Arabinose Purity >99% (HPLC)
S5018.1000 Arbutin Purity >98% (HPLC)
S5019.0000 3-Azido-1-O-dimethyl-t-butylsilyl-2,3,6-trideoxy-ß-L-arabino-hexopyranose
S5020.0001 O-(2-Azido-2-deoxy-3,4,6-tri-O-acetyl-ß-D-galacto­pyranosyl)-trichloracetimidat
S5021.0001 2-Azido-2-deoxy-1,3,4,6-tetra-O-acetyl-a-D-galacto­pyranose
S5022.0001 2-Azido-2-deoxy-1,3,4,6-tetra-O-acetyl-a,b-D-galacto­pyranose
S5023.0001 2-Azido-2-deoxy-1,3,4,6-tetra-O-acetyl-a-D-gluco­pyranose
S5024.0250 2-Azido-2-deoxy-1,3,4,6-tetra-O-acetyl-ß-D-gluco­pyranose
S5025.0001 2-Azido-2-deoxy-4-O-(2,3,4,6-tetra-O-acetyl-b-D-galactopyranosyl)-1,3,6-tri-O-acetyl-a,b-D-gluco­pyranose
S5026.0001 2-Azido-2-deoxy-1,3,4,6-tetra-O-acetyl-a-D-manno­pyranose
S5027.0001 Benzyl 2-acetamido-4,6-O-benzylidene--2-deoxy-a-D-glucopyranoside TLC: one spot
S5028.0001 Benzyl 2-acetamido-2-deoxy-a-D-glucopyranoside TLC: one spot Purity > 99% (HPLC)
S5029.0001 Benzyl a-D-mannopyranoside
S5030.0010 D(+)-Cellobiose
S5031.0025 D-(+)-Arabitol
S5032.0005 alpha-Cyclodextrin Purity >98.0%
S5033.0025 beta-Cyclodextrin Purity > 99.0%
S5034.0001 gamma-Cyclodextrin Purity > 98.0%
S5035.0005 1,2:3,4-Di-O-isopropylidene-a-D-fucose TLC: one spot
S5036.0001 2-Deoxy-D-erythro-pentose Purity >99% (HPLC)
S5037.0001 2-Deoxy-ß-D-galactose Purity >99% (HPLC)
S5038.0005 3,4-Di-O-acetyl-L-rhamnal Purity >98% (GC)
S5039.0005 3,6-Di-O-acetyl-4-O-(2,3,4,6-tetra-O-acetyl-ß-D-galactopyranosyl)-D-glucal Purity: >99% (HPLC)
S5040.0025 1,4:3,6-Dianhydro-D-mannitol Purity: >99% (HPLC) TLC (one spot)
S5041.0025 1,2,3,4-Di-O-isopropylidene-a-D-galactopyranose Purity: >98% (HPLC)
S5042.0100 D(+)-Galactose from beech (min. 98.0% HPLC)
S5043.0025 1,2:5,6-Di-O-isopropylidene-D-mannitol
S5044.0025 2,3:5,6-Di-O-isopropylidene-a-D-mannofuranose Purity: >99% (HPLC)
S5045.0010 1,2:3,5-Di-O-isopropylidene-a-D-xylofuranose Purity >98%
S5046.0500 D(-)-Fructose BioChemica (min. 99.0% HPLC)
S5047.0001 D-Fucose (6-Deoxy-D-galactose); Purity > 99% (TLC)
S5048.0001 L-Fucose (6-Deoxy-L-galactose), min. 99.6% (TLC)
S5049.0100 D(+)-Galactose from lactose (min. 98.0% HPLC)
S5050.0001 D-Galactosamine x HCl
S5051.0500 D(+)-Glucose anhydrous Biochemica (min. 99.0%)
S5052.0500 D(+)-Glucose anhydrous Cell culture grade (min 99.0%)
S5053.0001 Lysozyme from chicken egg, ca. 20.000 U/mg
S5054.1000 D(+)-Glucose monohydrate Biochemica (99.0%)
S5055.1000 D(+)-Glucose monohydrate Molbio Grade (99.0%)
S5056.0001 L-Glucose Purity > 99% (HPLC)
S5057.0250 D-Glucosamine x HCl Purity > 99% (HPLC)
S5058.0001 Hyaluronic acid sodium salt
S5059.0100 1,2-O-Isopropylidene-a-D-glucofuranose (min. 98%)
S5060.0005 3,4-O-Isopropylidene-D-mannitol (min. 99.0% GLC)
S5061.0010 1,2-O-Isopropylidene-a-D-xylofuranose (min. 98%)
S5062.0005 Lactitol monohydrate (min. 99.0% HPLC)
S5063.0500 D(+)-Lactose monohydrate, BioChemica
S5064.0500 D(+)-Lactose monohydrate, Molecular biology grade
S5065.0005 beta-Lactose-octaacetate (min. 99.0% HPLC)
S5066.0025 Lactulose crystal. (min. 99.0% HPLC)
S5067.0010 D-Lyxose Purity > 99% (HPLC)
S5068.0001 Maltodextrin pure
S5069.0250 D(+)-Maltose monohydrate Biochemica (min. 98.0% HPLC)
S5070.0005 beta-Maltose octaacetate (min. 99.0% HPLC)
S5071.0001 Maltulose monohydrate (min. 99.0% HPLC)
S5072.0500 D-Mannitol Purity >99.3%
S5073.0025 D-Mannose Purity >99% (HPLC)
S5074.0001 L-Mannose Purity >99% (HPLC)
S5075.0001 Methyl 2-azido-2-deoxy-3,4,6-tri-O-acetyl-ß-D-manno­pyranoside
S5076.0005 Methyl 4,6-O-benzylidene-ß-D-galactopyranoside
S5077.0005 Methyl 4,6-O-benzylidene-a-D-glucopyranoside
S5078.0005 Methyl 4,6-O-benzylidene-ß-D-glucopyranoside
S5079.0005 Methyl 6-deoxy-a-L-manno­pyranoside
S5080.0001 Methyl a-D-fucopyranoside Purity (HPLC) >99%
S5081.0001 Methyl a-L-fucopyranoside Purity (HPLC) >99%
S5082.0005 Methyl ß-D-galactopyranoside Purity >99%(HPLC)
S5083.0005 Methyl ß-D-glucopyranoside hemihydrate Purity >99% (HPLC)
S5084.0001 Methyl ß-D-ribopyranoside Purity >99% (HPLC)
S5085.0005 Methyl 2,3,5-tri-O-benzoyl-a-D-arabinofuranoside
S5086.0001 Panose Purity > 99% (HPLC)
S5087.0025 1,2,3,4,6-Penta-O-acetyl-ß-D-galactopyranose
S5088.0025 1,2,3,4,6-Penta-O-acetyl-a-D-mannopyranose
S5089.0001 Phenyl 2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-a-D-galactopyranoside
S5090.0005 Phenyl-ß-D-galactopyranoside (min. 99.0%)
S5091.0025 D-Raffinose pentahydrate (min. 99.9% HPLC)
S5092.0100 L-Rhamnose monohydrate (min. 99.0%)
S5093.0050 D-Ribose (min. 99.0%)
S5094.0001 L-Ribose (min. 99.0 HPLC)
S5095.0500 D(-)-Sorbitol (98.0 - 101%)
S5096.0000 Wheat starch granule (C6H10O5)n Purity >97%
S5097.0001 D-Tagatose Purity >99% (HPLC)
S5098.0001 a-D-Talose Purity >99% (HPLC)
S5099.0001 2,3,4,6-Tetra-O-acetyl-ß-D-galactopyranosyl azide Purity >99% (HPLC)
S5100.0025 2,3,4,6-Tetra-O-acetyl-a-D-galactopyranosyl bromide Purity 99% (TLC)
S5101.0001 2,3,4,6-Tetra-O-acetyl-ß-D-glucopyranosyl azide Purity >99% (HPLC)
S5102.0025 2,3,4,6-Tetra-O-acetyl-a-D-glucopyranosyl bromide Purity 99% (TLC)
S5103.0001 2,3,4,6-Tetra-O-acetyl-a-D-glucopyranosyl fluoride Purity 99% (HPLC)
S5104.0001 2,3,4,6-Tetra-O-acetyl-ß-D-glucopyranosyl-isothiocyanate Purity >98%
S5105.0001 1,3,4,6-Tetra-O-acetyl-ß-D-mannopyranose Purity 99% (HPLC)
S5106.0001 2,3,4,6-Tetra-O-acetyl-a-D-mannopyranose Purity 99% (HPLC)
S5107.0025 1,2,3,5-Tetra-O-acetyl-ß-D-ribofuranose Purity >99% (HPLC)
S5108.0001 2,3,4,6-Tetra-O-acetyl-1-thio-ß-D-galactopyranose Purity >99.5% (GC-MS)
S5109.0001 2,3,4,6-Tetra-O-acetyl-1-thio-ß-D-glucopyranose Purity >99%
S5110.0001 2,3,4,6-Tetra-O-benzyl-a-D-galactopyranose Purity >99% (HPLC)
S5111.0010 2,3,4,6-Tetra-O-benzyl-a-D-glucopyranose Purity >98% (HPLC)
S5112.0001 2,3,4,6-Tetra-O-benzyl-a-D-mannopyranose Purity >97% (HPLC)
S5113.0001 1-Thio-ß-D-galactose sodium salt
S5114.0001 1-Thio-ß-D-glucose sodium salt dihydrate
S5115.0001 D(+)-Trehalose dihydrate Purity >99% (HPLC)
S5116.0005 3,4,6-Tri-O-acetyl-D-galactal Purity >97% (HPLC)
S5117.0001 2,3,4-Tri-O-benzyl-L-fucopyranose > 99% (HPLC)
S5118.0005 D-Turanose >99.0% (HPLC)
S5119.0250 D-Xylose (min. 99.0% HPLC)
S5120.0001 2-Acetamido-2-deoxy-D-galactose
S5121.0025 D-Ribulose
S5122.0025 D-Xylulose (min. 99%)
S5130.0001 n-Octyl-ß-D-glucopyranoside (min. 99.0% TLC)
S5131.0001 n-Octyl-ß-D-glucopyranoside (min. 99.5% TLC)
S5132.0001 n-Nonyl ß-D-glucopyranoside (min. 99.0% TLC)
S5133.0001 n-Decyl-ß-D-glucopyranoside (min. 99.0% TLC)
S5134.0001 n-Dodecyl-ß-D-glucopyranoside (min. 99.0% TLC)
S5135.0001 n-Nonyl ß-maltoside (NM) > 99%
S5146.0001 n-Nonyl ß-maltoside (NM) > 99.5%
S5147.0001 n-Decyl-ß-maltoside (DM) > 99%
S5148.0001 n-Decyl-ß-maltoside (DM) > 99.5% for crystallography
S5149.0001 n-Undecyl-ß-maltoside > 99.0%
S5150.0001 n-Dodecyl-ß-maltoside (DDM) > 99%
S5151.0001 n-Dodecyl-ß-maltoside (DDM) > 99.5%
S5152.0001 n-Tridecyl-ß-maltoside (TDM) > 99.5%
S5153.0001 n-Octyl 1-thio-ß-D-glucopyranoside
S5154.0001 MEGA-8
S5155.0001 MEGA-9
S5156.0001 MEGA-10
S5157.0001 n-Undecyl-ß-maltoside > 99.5% for crystallography
S5158.0100 rAminopeptidase
S5159.0050 rHuAPC
S5160.0010 rATP-sulfurylase
S5161.0001 rec. beta-Lactamase
S5162.0010 rHuBHMT
S5163.0005 rHuCAIII
S5164.0010 rHuCDC34
S5165.0020 rHuCyclophilin-B
S5166.0500 rHuDNase
S5167.0010 rDsbA
S5168.0010 rDsbC
S5169.0010 rDMGO
S5171.0020 rbEnterokinase
S5172.0020 rHuEnterokinase
S5173.0100 pEnterokinase
S5174.0005 rHuGPBB
S5175.0100 rHuHPA1
S5176.0020 rhHMTase
S5177.0020 HRP
S5178.0010 rHuHTRA2
S5179.0001 riCDH
S5193.0001 a-D-Galactopyranose-phosphate di-potassium salt dihydrate (min. 99.0% HPLC)
S5194.0005 a-D-Glucopyranose-phosphate di-potassium salt dihydrate (min. 99.0% HPLC)
S5195.0001 a-D-Mannopyranose-phosphate di-potassium salt dihydrate (min. 99.0% HPLC)
S5196.0010 rHuJO-1
S5197.0500 L-Asparaginase
S5198.0005 rHuFTCD
S5199.0001 rLDH
S5200.0005 rHuLKM-1
S5201.0001 rLysostaphin
S5202.1000 rMDH
S5203.1010 rMMLV-RT
S5204.0005 rHuMMP-7
S5205.0005 rProMMP-7
S5206.0005 rHuMMP-3
S5207.0001 rHuMMP-13
S5208.0001 D(+)-Melezitose
S5209.0002 rHuNGAL
S5210.0002 rHuMPO
S5211.0002 rHuNSE
S5212.0100 D(+)-Galactose cell culture grade (min. 99.0% HPLC)
S5213.0500 D(+)-Glucose anhydrous molecular biology grade (min. 99.0%)
S5214.0500 D(+)-Glucose monohydrate molecular biology grade (99.0%)
S5215.0002 rHuPON2
S5216.0001 Manumycin A
S5217.0001 Herbimycin A
S5218.0050 Ribonuclease A (DNAse free)
S5219.0005 E-64
S5220.0005 (+)-Aphidicolin, high pure
S5221.0100 Etoposide
S5222.0010 N-(3-Oxooctanoyl)-DL-homoserine Lactone
S5223.0100 ß-Agarase (EC 3.2.1.81)
S5224.0250 Ascorbate oxidase (EC 1.10.3.3)
S5225.0025 Bromelain (EC 3.4.22.32)
S5226.0025 Catalase (EC 1.11.1.6). Ca. 11000 U/mg
S5226.0100 Catalase (EC 1.11.1.6). Ca. 1800 U/mg
S5226.1000 Catalase (EC 1.11.1.6). Ca. 11000 U/mg
S5227.0001 rHuMMP-8
S5228.0001 alpha-Chymotrypsin (EC 3.4.21.1), grade I
S5229.0001 alpha-Chymotrypsin (EC 3.4.21.1), grade II
S5230.0001 Chymotrypsinogen A
S5231.0100 Ribonuclease A (RNAse A)
S5232.0001 Glucose Oxidase (EC 1.1.3.4)
S5233.0002 PAF-AH (PLA2G7)
S5234.0001 Hyaluronidase (EC 3.2.1.35)
S5235.0025 Lipase (EC 3.1.1.3)
S5236.0015 Lipoxidase (EC 1.13.11.12)
S5237.0001 Lysozyme from chicken egg, ca. 20.000 U/mg
S5238.0001 Micrococcal nuclease
S5239.0100 Pancreatin
S5240.0025 Papain
S5241.0025 Pepsin (EC 3.4.23.1)
S5242.0025 N-(3-Oxodecanoyl)-DL-homoserine Lactone
S5243.0025 N-(3-Oxoundecanoyl)-DL-homoserine Lactone
S5244.0010 N-(3-Oxododecanoyl)-DL-homoserine Lactone
S5245.0025 N-(3-Oxotridecanoyl)-DL-homoserine Lactone
S5246.0005 5' Carboxy-Fluorescein (5-FAM), single isomer
S5247.0005 6'-Carboxy-Fluorescein (6-FAM), single isomer
S5248.0005 5-Carboxy-Tetramethylrhodamine (5-TAMRA), single isomer
S5249.0005 6-Carboxy-Tetramethylrhodamine (6-TAMRA), single isomer
S5250.0005 5-Carboxy-X-Rhodamin (5-ROX), single isomer
S5251.0005 6-Carboxy-X-Rhodamin (6-ROX), single isomer
S5252.0005 MANT (N-Methylanthranilic acid)
S5253.0005 DY-633
S5254.0005 DY-675
S5255.0005 DY-651
S5256.0005 Fluorescein Protein Labeling Kit
S5257.0005 Tetramethylrhodamine Protein Labeling Kit
S5258.0005 X-Rhodamine Protein Labeling Kit
S5259.0001 Amylose (from potato)
S5260.0001 recom. Mammalian (HIS)6 Ubiquitin
S5261.0025 mammalian 20S Proteasome
S5262.0200 Mammalian 26S-Proteasome Fraction
S5263.0200 Antiserum to NEDD8
S5264.0050 Antiserum to Ubc9
S5265.0002 rHuACAD8
S5266.0005 rHuACAT2
S5267.0002 rHuACY1
S5268.0002 rHuADAT1
S5269.0001 rHuALAT
S5270.0002 rHuAMD1
S5271.0001 Angiotensin
S5272.0025 N-(3-Oxotetradecanoyl)-DL-homoserine Lactone
S5273.0025 N-(12-Bromo-3-oxododecanoyl)-DL-homoserine Lactone
S5274.0025 N-(13-Bromo-3-oxotridecanoyl)-DL-homoserine Lactone
S5275.0025 N-(13-Carboxy-3-oxotridecanoyl)-DL-homoserine Lactone
S5276.0025 N-(12-Methoxycarbonyl-3-oxododecanoyl)-L-homoserine Lactone
S5277.0025 N-(12-Hydroxy-3-oxododecanoyl)-DL-homoserine Lactone
S5278.0025 N-(3-Oxo-7Z-tetradecenoyl)-DL-homoserine Lactone
S5279.0025 N-(3-Oxo-10Z-tetradecenoyl)-DL-homoserine Lactone
S5280.0025 N-(3-Oxo-12-tridecenoyl)-DL-homoserine Lactone
S5281.0025 N-(3-Oxo-13-tetradecenoyl)-DL-homoserine Lactone
S5282.0025 N-(6-Methyl-3-oxoundecanoyl)-DL-homoserine Lactone
S5283.0025 N-(3-Hydroxydodecanoyl)-DL-homoserine Lactone
S5284.0025 N-(3-Hydroxytetradecanoyl)-DL-homoserine Lactone
S5285.0025 N-Decanoyl-DL-homoserine Lactone
S5286.0025 N-Undecanoyl-DL-homoserine Lactone
S5287.0025 N-Dodecanoyl-DL-homoserine Lactone
S5288.0025 N-(3-Oxododecanoyl)-DL-homoserine Methyl Ester
S5289.0025 3-Oxododecanamide
S5290.0025 N-(3-Oxododecanoyl)-DL-homocysteine Thiolactone
S5291.0100 rHuPDI
S5292.0002 rHuPLAP
S5293.0005 rHuPL-7
S5294.0005 rHuPL-12
S5295.0002 rHuPLA2 IIA
S5296.0002 rHuPLA2 IB
S5297.0002 rHuPLA2 IID
S5298.0002 rHuPLA2 IIE
S5299.0002 rHuPLA2 V
S5300.0032 CentriSep Dye Terminator Removal
S5300.0050 ProSpin Columns
S5300.0100 CentriSep Dye Terminator Removal
S5301.0000 CentriSpin Combi Pack for DNA, RNA and protein purification
S5301.1020 CentriSpin 10 Columns for DNA, RNA and protein purification
S5301.2020 CentriSpin 20 Columns for DNA, RNA and protein purification
S5301.4020 CentriSpin 40 Columns for DNA, RNA and protein purification
S5302.0550 Big BAC DNA Isolation Kit
S5303.0296 CentriSep 96 High Throughput dye terminator purification kit
S5303.2196 PSI Clone 96 high throughput PCR purification kit
S5303.5096 CentriSep 96 High Throughput dye terminator purification kit
S5304.0010 2-Hydroxyestradiol
S5305.0010 Calpain Inhibitor I
S5306.0010 Calpain Inhibitor II
S5307.0200 Clasto-Lactacystin beta-lactone
S5308.0050 Epoxomicin
S5309.0003 Fraction I (Frl. Hela)
S5310.0003 Fraction II (FII from Hela cells)
S5311.0003 Fraction II (FII from rabbit reticulocytes)
S5312.0002 rHuPLA2 X
S5313.0001 Lactacystein, min. 95%
S5314.0001 methylated Ubiquitin, min. 95%
S5315.0001 Proteasome Inhibitor MG-115
S5316.0001 MG-132, min. 95.0%
S5317.0025 PA28 Activator, min. 95.0%
S5318.0002 rHuPLA2 XII
S5319.0005 rHuPIN-1
S5320.0005 6a-Hydroxyestradiol
S5321.0020 rStaphylokinase
S5322.0005 rHuTOP1
S5323.0015 rStreptokinase
S5324.0002 HuPAI1
S5325.0002 rHuTOPO IIb
S5326.0020 rHutPA
S5327.0005 rhTPO
S5328.0005 rHut-TG
S5329.0002 rHuTYR
S5330.0005 Proteasome Inhibitor I
S5331.0005 Proteasome Inhibitor II
S5332.0005 Proteasome Substrate I (fluorogenic), min. 95%
S5333.0001 Proteasome Substrate II (fluorogenic), min. 95%
S5334.0005 Proteasome Substrate III (fluorogenic), min. 95%
S5335.0200 Proteasome Inhibitor MG-262
S5336.0001 Muristerone A, min. 95%
S5337.0004 JustSpin Gel Extraction columns
S5338.0010 rhUbC3
S5339.0010 rhUbC7
S5340.0010 rHuUbC7
S5341.0010 rHuUbc9
S5342.0010 rhUbC9
S5343.0010 rhUbC10
S5344.0010 rhUbC12
S5345.0010 rHuUBE2B
S5346.0010 rHuUBE2D3
S5347.0001 rUrease
S5348.0100 rUOX
S5349.0005 rTrxR
S5350.0005 Immunosorb A
S5351.0002 rHuSTAT-1
S5352.0002 rHuSTAT-3
S5353.0005 Ni-IDA Agarose
S5354.0005 Highflow Ni-IDA Agarose
S5355.0005 6a-Hydroxyestratriol
S5356.0010 16a-Hydroxyestrone, approx. 95%
S5357.0010 16b-Hydroxyestrone
S5358.0010 6-Ketoestradiol
S5359.0025 16-Ketoestradiol
S5360.0001 1,3,5(10)-ESTRATRIEN-3-OL-17-ONE
S5361.0001 Estrone / Estrol
S5362.0050 1,5(10)-ESTRADIEN-3b-OL-17-ONE
S5363.0005 rHuPAI1
S5364.0002 rHuPON1
S5365.0001 Melittin (95%)
S5365.0002 Melittin (98%)
S5366.1000 TEV Protease
S5367.1100 Serratia Nuclease
S5368.0050 PCR DNA Purification Mini Prep Kit
S5369.0050 Plasmid DNA Purification Mini Prep Kit
S5370.0005 Co-IDA Agarose
S5371.0005 Highflow Co-IDA Agarose
S5372.5001 Pre-Packed Co-IDA Agarose columns
S5373.5001 Pre-Packed Ni-IDA Agarose columns
S5374.0050 Gel extraction Kit
S5375.0050 Cell/Blood Genomic-DNA Purification Mini Spin Column Kit
S5376.3001 IDA/NTA-Agarose Testkit
S5377.0005 Ni-NTA-Agarose
S5378.0050 Tissue Genomic-DANN Purification Mini Spin Column Kit
S5399.0025 Sodium diatrizoate dihydrate (99.0%)
S5400.0025 Ethylhexonate-6-O-(N,N-diisopropyl)-ß-cyanoethyl-phosphoramidite
S5401.0050 FOAA
S5402.0025 Guanosine-5'-thiophosphate
S5403.0050 Dabcyl-5’-phosphoramidite
S5404.0050 Dabcyl-3’-phosphoramidite
S5405.0105 Modified Trypsin (Porcine)
S5406.0305 Modified Arginine-C
S5407.0305 Modified Lysine-C
S5408.0050 Modified Glutamic-C
S5409.0001 5/6 FAM mixed isomers
S5410.0001 5/6-TAMRA, mixed isomers
S5411.0100 5/6-ROX, mixed isomers
S5412.0025 5-FAM, single isomer
S5413.0025 6-FAM, single isomer
S5414.0025 5-TAMRA, single isomer
S5415.0025 6-TAMRA, single isomer
S5416.0025 5-ROX, single isomer
S5417.0025 6-ROX, single isomer
S5418.0250 DABCYL
S5419.0020 5/6-FAM-SE, mixed isomers
S5420.0025 5/6 TAMRA-SE, mixed isomers
S5421.0020 5/6 ROX-SE, mixed isomers
S5422.0020 5/6-FAM SE
S5423.0005 5-FAM-SE, single isomer
S5424.0005 6-FAM-SE, single isomer
S5425.0010 5-TAMRA-SE, single isomer
S5426.0010 6-TAMRA-SE, single isomer
S5427.0005 5-ROX-SE, single isomer
S5428.0005 6-ROX-SE, single isomer
S5429.0025 DABCYL-SE
S5430.0025 DABCYL-IA
S5431.0100 6-Carboxyfluorescein-Piv2
S5432.0100 5-TAMRA-phosphoramidite
S5433.0100 6-TAMRA-phosphoramidite
S5434.0025 Fluorescein-5-maleinimide
S5435.0050 NIR_797-ITC
S5436.0425 Modified Chymotrypsin (Bovine)
S5437.0100 Collagenase Substrate
S5438.0001 DAR-1
S5439.0001 DAF-2
S5440.0001 DAF-2 DA
S5441.0001 DAR-2
S5442.0001 DAF-2T
S5443.0305 Modified Aspartic-N
S5444.0020 5/6-JOE mixed isomer
S5445.0100 Alcian Blue 8GX
S5446.0001 DAR 1T
S5447.0025 Amplex Red
S5448.0005 5-JOE single isomer
S5449.0001 DAF-FM
S5450.0001 DAF-FM DA
S5451.0005 Coumarin 6
S5452.0005 Coumarin 120, AMC
S5453.0000 Coumarin 151
S5454.0005 6-JOE single isomer
S5455.0005 Monocarboxymethylene Blue
S5456.0020 5/6-JOE-SE mixed isomer
S5457.0005 5-JOE-SE single isomer
S5458.0005 6-JOE-SE single isomer
S5459.0005 Monocarboxymethylene Blue-SE
S5460.0250 DiSC(3)(3)
S5461.0010 EthD-1, EtDi
S5462.0001 DAF-4
S5463.0001 DAF-4T
S5464.0001 DAR-2T
S5465.0001 DAR-4MT
S5466.0100 7-Acetoxy-1-methyl-quinolinium iodide
S5467.0100 2-Anthracenylsulfonyl chloride
S5468.0010 DAN-1 EE T
S5470.0100 9-Anthracenecarbaldehyde
S5471.0010 O'-(Carboxymethyl)fluoresceinamide
S5472.0500 10-Dodecylacridine Orange Bromide
S5473.0100 Dihydroethidium
S5474.0000 Coumarin 16
S5475.0125 FAMC
S5476.0050 3-Acetyl-umbelliferone
S5477.0050 9,10-Anthracenediyl-bis(methylene)dimalonic acid
S5478.0025 AVG-HCl
S5479.0050 MPAC-Br
S5480.0100 6-FAM DA
S5481.0010 6-FAM DA SE
S5482.0005 Ru(bpy)2(mcbpy-O-Su-ester)(PF6)2
S5483.0010 7-Diethylamino-3-[N-(4-maleimidopropyl)carbamoyl]coumarin
S5484.0100 7-Methoxy-4-trifluoromethylcoumarin
S5485.0010 BTBCT
S5486.0250 (+)-Bicuculline
S5487.0500 3-Cyanoumbelliferone
S5488.0050 2-(4-Maleinimidophenyl-6-methylbenzothiazole
S5489.0010 NBD-Cl
S5490.0010 PPS-Cl
S5491.0025 FQ
S5492.0050 MPAC-Br
S5493.0100 DIB-Cl
S5494.0010 DACB-CN
S5495.0050 Physil chloride
S5496.0025 6-(4-Acetamido-1,8-naphthalamido)hexanoic acid
S5497.0100 DAN
S5498.0100 PyTC2
S5499.0005 BMC, Br-MMC
S5500.0010 NBD-Cl
S5501.0100 NBD-PZ
S5502.0001 Diphenyliodonium trifluoromethansulfonate
S5503.0025 5(6)-Carboxy-DCF DA SE
S5504.0025 DIHFP
S5505.0100 5(6)-FAM DA SE
S5506.0000 Dansylchloride
S5507.0100 7-Diethylaminocoumarin-3,4-dicarboxylic acid
S5508.0010 CPM
S5509.0010 7-Diethylamino-3-[N-(4-maleimidoethyl)carbamoyl]coumarin
S5510.0250 5-FITC (ca. 98%)
S5511.0100 6,7-Dimethoxy-4-coumarinylacetic acid
S5512.0050 6,7-Dimethoxy-4-trifluoromethylcoumarin
S5513.0500 rHu cellular Fibronectin
S5514.0025 5-Maleinimido-eosin
S5515.0500 NBD-X
S5516.0100 6,7-Dihydroxy-4-coumarinylacetic acid
S5517.0000 5(6)-SFX SE
S5518.0005 5-Aminofluorescein
S5519.0000 AMCA-H NHS
S5520.0500 AMCA-H
S5521.0100 5-FAM DA
S5522.0000 Eosin-5-iodoacetamide
S5523.0000 Eosin-5-isothiocyanate
S5524.0500 6,7-Diethoxy-4-methylcoumarin
S5525.0100 7-Diethylaminocoumarin-3 carboxylic acid imidazolide
S5526.0100 DCCH
S5527.0050 6,7-Diethoxy-4-trifluoromethylcoumarin
S5528.0500 7-Diethylaminocoumarin-3-carboxylic acid
S5529.0100 DCCS
S5530.0001 4-Di-2-ASP
S5531.0100 5/6-FAM DA
S5532.0000 7-Aminoactinomycin D
S5533.0025 7-Methoxy-4-coumarinylacetic acid N-succinimidyl ester
S5534.0001 7-Methoxycoumarin-3-carbonic acid
S5535.0100 7-Methoxycoumarin-3-carbonic acid N-succinimidyl ester
S5536.0025 Colcemid
S5537.0050 PCPF
S5538.0005 Colchicine
S5539.0100 5/6-FAM DA SE
S5540.0010 6-FAM DA SE
S5541.0010 6-CS-Cl
S5542.0025 (+)-8,8-Dichlorocampherylsulfonyl-oxaziridine
S5543.0005 6-Aminofluorescein
S5544.0000 EITC
S5545.0250 5/6 FITC
S5546.0100 5/6-FITC-2DA
S5547.0000 5-FTSC
S5548.0100 5-FITC-2DA
S5549.0050 6-FITC-2DA
S5550.0010 IDA
S5551.0001 DACM
S5552.0001 Lucigenin
S5553.0001 rHu Vitronectin
S5554.0050 DPM
S5555.0001 rHu Decorin
S5556.0001 rHu Thrombospondin
S5557.0100 rHu HER2-ECD
S5558.0100 rHU EpCAM
S5559.0500 8-Acetoxypyrene-1,3,6-trisulfonic acid trisodium salt
S5560.0500 8-Butyryloxypyren-1,3,6-trisulfonic acid trisodium salt
YHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFA NLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS."