Catalogue > Antibodies & Cytokines > Polyclonals > RF0013-1

Rabbit anti-human Interferon a-2a antibody 1 mg - RF0013-1

1.107,75 EUR

excl. Shipping costs Product No.: RF0013-1


Package Size: 1 mg Polyclonal IgG Anti Human Interferon ? 2a is developed in rabbit using recombinant Human Interferon ? 2a expressed in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE.

pdf Rabbit anti-human Interferon a-2a antibody Productdetails (pdf)

Application: ELISA: to detect Human Interferon ? 2a by indirect ELISA a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1ng /well of human Interferon ? 2a. Western Blot: to detect human Interferon ? 2a by WB analysis this antibody can be used in a dilution of 1/1,500.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping / Storing Information: shipped on blue-ice, store at -20°C

Productnumber: RF0013-1

changedate: 22.8.2011


Print product data sheet