Catalogue > Antibodies & Cytokines > Polyclonals > RF0015-1

Rabbit anti-human TGF-ß2 antibody 1 mg - RF0015-1

1.107,75 EUR

excl. Shipping costs Product No.: RF0015-1


Package Size: 1 mg Polyclonal IgG Anti Human TGF?-2 is developed in rabbit using recombinant Human TGF?-2 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS.

pdf Rabbit anti-human TGF-ß2 antibody Productdetails (pdf)

Application: Western Blot: to detect human TGFß-2 by WB analysis this IgG can be used in a dilution of 1/500 - 1/1,000.

Source: Rabbit

Technical Data: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.

Shipping / Storing Information: shipped on blue-ice, store at -20°C

Productnumber: RF0015-1

changedate: 22.8.2011


Print product data sheet