Catalogue > Monoclonals > Polyclonals


Polyclonals

Rabbit anti-HGH antibody - Rabbit anti-human Activin A antibody - Rabbit anti-human BMP-7 antibody - Rabbit anti-human Interferon a-2a antibody - Rabbit anti-human LXR-ß antibody - Rabbit anti-human Myostatin antibody - Rabbit anti-human TFPI-2 antibody - Rabbit anti-human TGF-ß2 antibody - Rabbit anti-human TGF-ß3 antibody


Rabbit anti-HGH antibody 1 mg - RF0014-1
1.221,29 EUR Package Size: 1 mg Polyclonal IgG Anti HGH (Human Growth Hormone, Somatotropin) has been developed in rabbit using highly pure (?98%) recombinant human HGH expressed in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: FPTI PLSRLFDNAM



Rabbit anti-HGH antibody 100 µg - RF0014
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti HGH (Human Growth Hormone, Somatotropin) has been developed in rabbit using highly pure (?98%) recombinant human HGH expressed in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: FPTI PLSRLFDNAM



Rabbit anti-human Activin A antibody 1 mg - RF0016-1
1.221,29 EUR Package Size: 1 mg Polyclonal IgG Anti Human Activin A is developed in rabbit using recombinant Human Activin A produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human Activin A antibody 100 µg - RF0016
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human Activin A is developed in rabbit using recombinant Human Activin A produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human BMP-7 antibody 1 mg - RF0017-1
955,04 EUR Package Size: 1 mg Polyclonal IgG Anti Human BMP 7 is developed in rabbit using recombinant Human BMP 7 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human BMP-7 antibody 100 µg - RF0017
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human BMP 7 is developed in rabbit using recombinant Human BMP 7 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human Interferon a-2a antibody 1 mg - RF0013-1
1.221,29 EUR Package Size: 1 mg Polyclonal IgG Anti Human Interferon ? 2a is developed in rabbit using recombinant Human Interferon ? 2a expressed in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human Interferon a-2a antibody 100 µg - RF0013
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human Interferon ? 2a is developed in rabbit using recombinant Human Interferon ? 2a expressed in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human LXR-ß antibody 1 mg - RF0020-1
955,04 EUR Package Size: 1 mg Polyclonal IgG Anti Human LXR is developed in rabbit using recombinant Human LXR produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human LXR-ß antibody 100 µg - RF0020
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human LXR is developed in rabbit using recombinant Human LXR produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human Myostatin antibody 1 mg - RF0022-1
955,04 EUR Package Size: 1 mg Polyclonal IgG Anti Human Myostatin is developed in rabbit using recombinant Human Myostatin produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human Myostatin antibody 100 µg - RF0022
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human Myostatin is developed in rabbit using recombinant Human Myostatin produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human TFPI-2 antibody 1 mg - RF0012-1
955,04 EUR Package Size: 1 mg Polyclonal IgG Anti Human TFPI-2 is developed in rabbit using recombinant Human Kunitz domain 1 from TFPI-2 in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: GAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.



Rabbit anti-human TFPI-2 antibody 100 µg - RF0012
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human TFPI-2 is developed in rabbit using recombinant Human Kunitz domain 1 from TFPI-2 in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen: GAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.



Rabbit anti-human TGF-ß2 antibody 1 mg - RF0015-1
1.221,29 EUR Package Size: 1 mg Polyclonal IgG Anti Human TGF?-2 is developed in rabbit using recombinant Human TGF?-2 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human TGF-ß2 antibody 100 µg - RF0015
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human TGF?-2 is developed in rabbit using recombinant Human TGF?-2 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity >98%. Immunogen:



Rabbit anti-human TGF-ß3 antibody 1 mg - RF0018-1
1.221,29 EUR Package Size: 1 mg Polyclonal IgG Anti Human TGF?-3 is developed in rabbit using recombinant Human TGF?-3 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity: >98%. Immunogen:



Rabbit anti-human TGF-ß3 antibody 100 µg - RF0018
225,74 EUR Package Size: 100 µg Polyclonal IgG Anti Human TGF?-3 is developed in rabbit using recombinant Human TGF?-3 produced in plants. Purified IgG prepared by affinity chromatography on protein G. Purity: >98%. Immunogen:



Show 1 to 18 (of in total 18 products) Sites:  1