Alzheimer Peptide

Characteristic of Alzheimer´s disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-β-peptides, which form insoluble fibrils via self-assembly. The amyloid-β-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by β- and γ-secretases.
Cleavage occurs after residue 40 or after residue 42. Even slightly increased amounts of amyloid-β-1-42 are described to be sufficient to cause Alzheimer's disease.

References:
M. Ahmed, J. Davis, D. Aucoin, T. Sato, S. Ahuja, S. Aimoto, J. I. Elliott, W. E. Van Nostrand, S. O. Smith (2010) Nat. Struct. Mol. Biol. 17, 561-567.
T. Hartmann, S. C. Bieger, B. Brühl, P. J. Tienari, N. Ida, D. Allsop, G. W. Roberts, C. L. Masters, C. G. Dotti, K. Unsicker, K. Beyreuther (1997) Nat. Med. 3, 1016-1020.

Characteristic of Alzheimer´s disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-β-peptides, which form insoluble... mehr erfahren »
Fenster schließen
Alzheimer Peptide

Characteristic of Alzheimer´s disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-β-peptides, which form insoluble fibrils via self-assembly. The amyloid-β-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by β- and γ-secretases.
Cleavage occurs after residue 40 or after residue 42. Even slightly increased amounts of amyloid-β-1-42 are described to be sufficient to cause Alzheimer's disease.

References:
M. Ahmed, J. Davis, D. Aucoin, T. Sato, S. Ahuja, S. Aimoto, J. I. Elliott, W. E. Van Nostrand, S. O. Smith (2010) Nat. Struct. Mol. Biol. 17, 561-567.
T. Hartmann, S. C. Bieger, B. Brühl, P. J. Tienari, N. Ida, D. Allsop, G. W. Roberts, C. L. Masters, C. G. Dotti, K. Unsicker, K. Beyreuther (1997) Nat. Med. 3, 1016-1020.

Filter schließen
  •  
  •  
 
von bis
  •  
  •  
  •  
  •  
Für die Filterung wurden keine Ergebnisse gefunden!
Amyloid-beta (16-20) KLVFF Inhibitorpeptid von Amyloid-beta Amyloid-beta (16-20) KLVFF Inhibitorpeptid von...
The KLVFF peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display...
103,27 € *
Amyloid-beta Peptid PGRSPFTGKKLFNQEFSQDQ Amyloid-beta Peptid PGRSPFTGKKLFNQEFSQDQ
Amyloid-beta peptide PGRSPFTGKKLFNQEFSQDQ. Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
ab 224,58 € *
[beta]-Amyloid (10-20) - YEVHHQKLVFF [beta]-Amyloid (10-20) - YEVHHQKLVFF
[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide. Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer...
249,31 € *
Amyloid-beta (1-42). Ratte DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Amyloid-beta (1-42). Ratte...
[beta]-Amyloid (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA belongs to the Amyloid-ß-peptides. The characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques...
ab 708,50 € * 745,79 € *
[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS [beta]-Amyloid/A4 Protein Precursor (APP) (328...
Aminosäuresequenz RERMS stellt die aktive Domäne des Amyloid-Beta / A4-Proteinvorläufers dar, die das Fibroblastenwachstum fördert; H. Ninomiya et al .; J. Cell. Biol. 121, 879 (1993). Das Merkmal der Alzheimer-Krankheit ist die...
103,27 € *
Kontrollpeptid Amyloid-beta (40-1) Ratte Kontrollpeptid Amyloid-beta (40-1) Ratte
Kontrollpeptid Amyloid-beta (40-1) von Ratte. Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 260,71 € *
Kontrollpeptid Amyloid-beta (40-1) human Kontrollpeptid Amyloid-beta (40-1) human
Kontrollpeptid Amyloid-beta (40-1). Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch...
ab 260,71 € *
RIIGL - Inhibitorpeptid von Amyloid-beta RIIGL - Inhibitorpeptid von Amyloid-beta
RIIGL is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches....
ab 163,20 € *
DWGKGGRWRLWPGASGKTEA - Inhibitorpeptid von Amyloid-beta DWGKGGRWRLWPGASGKTEA - Inhibitorpeptid von...
DWGKGGRWRLWPGASGKTEA peptide is one of several inhibitors of amyloid-beta aggregation that have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by...
ab 224,54 € *
FYLKVPSSLHHHHGRDKLVFFHHHH FYLKVPSSLHHHHGRDKLVFFHHHH
Several inhibitors of amyloid-beta aggregation have been published. Many of them are fragments and modified peptides derived from the native amyloid-beta sequence. Others were identified by phage display approaches. An overview about...
ab 213,89 € *
Alzheimer Peptide NYSKMIFSHHHH Peptid: NYSKMIFSHHHH
Das Peptid: NYSKMIFSHHHH ist einer von verschiedenen publizierten Inhibitoren der amyloid-beta Aggregation. Viele dieser Inhibitoren sind Fragmente und/oder modifizierte Peptide der nativen amyloid-beta Sequenz. Andere wiederum wurden...
ab 163,46 € *
Ac-KLVFF-NH2 Ac-KLVFF-NH2
Ac-KLVFF-NH2 is the N-terminal and C-terminal modified form of the amyloid-beta (16-20) inhibitor peptid KLVFF. The modification leads to higher stability against peptidases. The KLVFF peptide is one of several inhibitors of amyloid-beta...
ab 163,46 € *