0,00 €*
Positionen anzeigen
 
 
Zurück
Vor
Amyloid-beta (1-40) Ratte

Amyloid-beta (1-40) Ratte

Gewicht

Reinheit

Hersteller Genaxxon bioscience



Artikel-Nr.: P2247.0001

shipped at RT, store at -20°C

 

Sofort versandfertig, Lieferzeit ca. 1-2 Werktage

220,60 € *
 
 
 
 
 

Produktinformationen "Amyloid-beta (1-40) Ratte"

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly. The amyloid-ß-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by ß- and g-secretases. Cleavage occurs after residue 40 or after residue 42. Even slightly increased amounts of amyloid-ß1-42 are described to be sufficient to cause Alzheimer's disease.

 
 
 

Technische Daten:

Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV; Purity: >95% (HPLC).

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90

Dokumente - Protokolle - Downloads

Hier finden Sie Infos und weiterführende Literatur zu Amyloid-beta (1-40) Ratte

  Produktbeschreibungen

   Allg. Daten 2

   Kategorienlisten

 
 
 

Kundenbewertungen für "Amyloid-beta (1-40) Ratte"

 
Bewertungen werden nach Überprüfung freigeschaltet.

Bewertung schreiben

 
 
 
 
 
 
 

Die mit einem * markierten Felder sind Pflichtfelder.

 
 
GreenMasterMix (2X) High ROX für...

ab 20,00 € * Statt: 75,00 € *

Biotinyliertes Amyloid-beta...

ab 431,63 € *

Cas9-NLS-EGFP

ab 215,00 € *

LyoBeads - vorportioniert in...

ab 0,01 € *

LyoCake - Lyophilisierter qPCR...

ab 25,00 € *

esiCRISPR Kit-wt

550,00 € *

Cas9-Dead-NLS-EGFP

ab 215,00 € *

Cas9-Dead-NLS

ab 195,00 € *

rek. humanes Serumalbumin (rHSA)

ab 242,55 € *

X-Gal /...

ab 36,80 € *

Gentamycinsulfat, 10 mg/mL

ab 44,57 € *

Doxycyclin - Hyclat

ab 28,72 € *

Taq DNA Polymerase S (Hohe...

ab 0,01 € * Statt: 15,00 € *

Aminosäureanalyse (oxidative...

235,75 € *

esiRNA - Positive Controls

ab 145,00 € *

single guide RNA - custom made

121,50 € *

CRISPRfect E...

120,00 € *

GFP-targeting guide RNA for CRISPR

57,50 € *

D-TAT (47-57) ygrkkrrqrrr-NH2

ab 263,37 € *

D-Arg9 (r9)

ab 263,37 € *

Arg9 (R9)

ab 141,25 € *

Influenza A NP (366-374) -...

ab 145,23 € *

Ac-KLVFF-NH2

ab 145,23 € *

KLVFF

ab 145,23 € *

Pam2Cys-SKKKK

ab 145,00 € *

Pam3Cys-SKKKK

ab 178,85 € *

No target guide RNA for CRISPR

57,50 € *