0,00 €*
Positionen anzeigen
 
 
Zurück
Vor
Kontrollpeptid Amyloid-beta (40-1) Ratte

Kontrollpeptid Amyloid-beta (40-1) Ratte

Gewicht

Reinheit

Hersteller Genaxxon bioscience



Artikel-Nr.: P2251.0001

shipped at RT, store at -20°C

 

Sofort versandfertig, Lieferzeit ca. 1-2 Werktage

220,60 € *
 
 
 
 
 

Produktinformationen "Kontrollpeptid Amyloid-beta (40-1) Ratte"

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly. The amyloid-ß-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by ß- and g-secretases. Cleavage occurs after residue 40 or after residue 42. Even slightly increased amounts of amyloid-ß1-42 are described to be sufficient to cause Alzheimer's disease.

 
 
 

Technische Daten:

Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHRVEFGSDHGFEAD; Purity: >95% (HPLC).

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90

Dokumente - Protokolle - Downloads

Hier finden Sie Infos und weiterführende Literatur zu Kontrollpeptid Amyloid-beta (40-1) Ratte

  Produktbeschreibungen

   Allg. Daten 2

   Kategorienlisten

 
 
 

Kundenbewertungen für "Kontrollpeptid Amyloid-beta (40-1) Ratte"

 
Bewertungen werden nach Überprüfung freigeschaltet.

Bewertung schreiben

 
 
 
 
 
 
 

Die mit einem * markierten Felder sind Pflichtfelder.

 
 
DAF-2 / 4,5-Diaminofluorescein -...

144,69 € * Statt: 222,60 € *

LyoBeads - vorportioniert in...

ab 0,01 € *

LyoCake - Lyophilisierter qPCR...

ab 25,00 € *

esiCRISPR Kit-wt

550,00 € *

Cas9-Dead-NLS-EGFP

ab 215,00 € *

Cas9-Dead-NLS

ab 195,00 € *

Cas9-Nickase-NLS

ab 195,00 € *

Cas9-NLS-tagRFP - Cas9 with red...

ab 215,00 € *

MOG (35-55) Ratte/Maus -...

319,56 € * Statt: 375,95 € *

Gentamycinsulfat, 10 mg/mL -...

ab 35,66 € * Statt: 44,57 € *

Cas9-NLS (CRISPR associated...

ab 195,00 € *

96-well Plate PCR DNA...

ab 299,25 € *

X-Gal /...

ab 36,80 € *

Gentamycinsulfat, 10 mg/mL

ab 44,57 € *

Doxycyclin - Hyclat

ab 28,72 € *

CentriPure P2 Säulchen für die...

ab 11,62 € *