Alzheimer Peptid mit erfolgreicher Phase I

Wie Transkript berichtet (, hat das Unternehmen Priavoid aus Jülich ( erfolgreich die Phase I bei der Anwendung von Peptiden zur Behandlung von Alzheimer abgeschlossen. Der Ansatz basiert auf D-enantiomeren Peptiden, also den Spiegelbildern der normalerweise vorkommenden Peptide aus L-Aminosäuren. Der Wirkstoff zerstört direkt und ohne Mitwirkung des Immunsystems die toxischen β-Amyloid-Oligomere und zerlegt diese in die ungefährlichen β-Amyloid-Monomere.

Wenn Sie Interesse an Peptiden mit D-Aminosäuren haben, können Sie sich gerne an Genaxxon wenden: oder schauen Sie unter: oder nach dem großen Angebot an Peptiden bei Genaxxon bioscience.

Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein

Die mit einem * markierten Felder sind Pflichtfelder.

Passende Artikel
ab 163,46 € *
Amyloid-beta (1-42). Ratte DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Amyloid-beta (1-42). Ratte...
ab 708,50 € * 745,79 € *
ab 163,46 € *