Für Ihre SARS-CoV-2-Forschung finden Sie bei Genaxxon die folgenden COVID-19-Forschungsprodukte:

- RNA-Isolierung: RT-PCR ohne isothermalen Zwischenschritt
- SARS-CoV-2-Detektion
- cDNA One-Step RT-PCR
- RNA-Reinigungskits
- Peptide und mehr

Die gezeigten Preise beziehen sich auf die Basispackungseinheit. Weitere Packungseinheiten, Informationen etc. finden Sie beim jeweiligen Produkt.

Eine Übersicht über unsere COVID-19-Produkte finden Sie hier >

Für Ihre SARS-CoV-2-Forschung finden Sie bei Genaxxon die folgenden COVID-19-Forschungsprodukte: - RNA-Isolierung: RT-PCR ohne isothermalen Zwischenschritt - SARS-CoV-2-Detektion - cDNA... mehr erfahren »
Fenster schließen

Für Ihre SARS-CoV-2-Forschung finden Sie bei Genaxxon die folgenden COVID-19-Forschungsprodukte:

- RNA-Isolierung: RT-PCR ohne isothermalen Zwischenschritt
- SARS-CoV-2-Detektion
- cDNA One-Step RT-PCR
- RNA-Reinigungskits
- Peptide und mehr

Die gezeigten Preise beziehen sich auf die Basispackungseinheit. Weitere Packungseinheiten, Informationen etc. finden Sie beim jeweiligen Produkt.

Eine Übersicht über unsere COVID-19-Produkte finden Sie hier >

Filter schließen
  •  
  •  
  •  
  •  
  •  
    •  
    •  
  •  
    •  
  •  
    •  
    •  
  •  
    •  
    •  
    •  
    •  
    •  
    •  
    •  
    •  
    •  
 
von bis
Für die Filterung wurden keine Ergebnisse gefunden!
Prod.Nr. Description     Price €
M3049.0010 Agarose LM - low melting 
Low melting Agarose von höchster Reinheit für die Trennung von RNA- und DNA-Fragmenten sowie für Proteine. Für die präparative Elektrophorese empfohlen.
Zubehör 55,00
M3016.0200 PCR dNTP-Mix (Na-salz) - 10 mM 
Premium dNTPs zu supergünstigen Preisen. Hochreine dNTPs (>99%) als fertiger 10mM Mix für die qPCR, Standard PCR oder RT-PCRs und Klenowreaktionen.
Zubehör 15,00
S5231.0100 Ribonuklease A (RNase A) 
Ribonuklease A ist eine Endo-Ribonuklease, die spezifisch Einzelstrang-RNA am 3'-Ende von Pyrimidinbasen (Cytosin und Uracil) schneidet. RNAse A wird...
Zubehör 48,03
M3037.0001 Proteinase K Lösung (20 mg/mL) 
Proteinase K aus dem Pilz Tritirachium album ist eine unspezifische Protease aus der Familie der Serinproteasen und wird für die Aufspaltung von Proteinen in...
Zubehör 10,50
M3278.0005 DL-Dithiothreitol (DTT) für die Molekularbiologie 
Reduziert quantitativ Disulfidgruppen. Bildet cyclisches Disulfid. Hygroskopisch. Dithioerythritol (DTE) ist ein Isomer des Dithiothreitol (DTT). Prinzipiell...
Zubehör 56,50
M3189.0020 Diethylpyrocarbonat - DEPC 
Diethylpyrocarbonat modifiziert Histidylreste in Proteinen und führt zu deren Inaktivierung. In der Molekularbiologie wird es als starker Inhibitor der...
Zubehör 73,80
M3044.0500 Agarose LE - Standardagarose 
Standardagarose für die elektrophoretische Trennung im Bereich 0,5bp bis 20kbp. Für analytische und präparative Gele. Vergleichbar mit SeaKem® LE. Diese...
Zubehör 0,01
M3015.4100 dNTP-Set (Na-Salz) - 100 mM Lösung 
Premium dNTP-Set supergünstig: dNTPs aus vorgefertigten wässrigen Lösungen von dATP, dCTP, dGTP und dTTP mit einer Konzentration von 100 mM (Reinheit: >99%)...
Zubehör 30,00
M3208.1000 Cäsiumchlorid hochrein (99,999%) 
Cäsiumchlorid für die Dichtezentrifugation. Ideal für die Isolation von hochreiner RNA ohne Kontamination von RNAsen, oder anderen Proteinen und DNA. Ref.:...
Zubehör 362,25
S5310.0100 Keramische Beads zur Zelllyse 
Keramische Beads für die Lyse von Gewebe aus einer großen Bandbreite an Probenmaterial für die Total RNA-Extraktion. Für weiches tierisches Gewebe aus z.B....
Reinigungskits 169,37
S5311.0050 RNA Mini Spin Reinigungssäulchen 
RNA Reinigungssäulchen für RNA Reinigungskits auch anderer Anbieter als günstige Alternative, falls Puffer aus Kits vorhanden, Säulchen aber verbraucht sind.
Reinigungskits 63,10
S5398.0050 Universal Genomic DNA Purification Mini Spin Kit 
Universell einsetzbarer DNA Reinigungs- und Isolationskit für hochreine, genomische DNA aus den unterschiedlichsten Proben, so z.B. genomische,...
Reinigungskits 37,13
S5304.0250L RLys - Lysepuffer für RNA Purification Kit 
Der RLys Lysepuffer ist für die Lyse von Zellen und Geweben im Vorfeld zur RNA-Isolation oder paralleler RNA/DNA/Protein Isolation einzusetzen.
Reinigungskits 113,30
S5320.0010 RNA Purification from Bacteria and Yeast Kit 
RNA Extraktions- und Reinigungkskit für Gesamt-RNA aus Bakterien und Hefe: Schnelle und effiziente Isolation von qualitativ hochwertiger RNA aus...
Reinigungskits 39,79
S5304.0010 Total RNA Purification Mini Spin Kit mit Antifoam Reagenz 
Total RNA Extraktions- und Purification Kit zur schnellen und effizienten Isolation von Total RNA aus oder kultivierten Zellen. Vergleichbar mit Qiagen...
Reinigungskits 39,79
S5305.0010 miRNA Purification Mini Spin Kit 
miRNA Extraktions- und Purification Kit für die schnelle und effiziente Isolation von microRNA aus Gewebe und Zellen, inklusive tRNA, 5S rRNA, 5.8S rRNA, siRNA.
Reinigungskits 41,91
S5304.10AF Antifoam Reagenz für Total RNA Purification Kit 
Antifoam Reagenz für die RNA-Aufreinigung. Keine Schaumbildung während der Homogenisierung, Bessere Lyse. Antifoam Reagenz für die RNA-Aufreinigung speziell...
Reinigungskits 18,57
S5318.0100 GENAzol - RNA Reinigungslösung 
Eigenschaften von GENAzol: - Ermöglicht die Isolierung von RNA, DNA und Protein aus der gleichen Probe - Überlegene Lyseeignung auch bei schwierigen Proben -...
Reinigungskits 97,50
S5301.0050 Viral RNA und DNA Purification Kit 
Das Kit wurde speziell entwickelt, um hochwertige Nukleinsäuren mit geringem Elutionsvolumina zu isolieren und eine nachgeschaltete Analyse wie quantitativer...
Reinigungskits 155,00
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g) 
Recombinant Human IFN-g wird in E.Coli als nicht-glykosyliertes Polypeptid aus 144 Aminosäuren und einer molaren Masse von 16.879 Dalton hergestellt....
Peptides and Proteins 145,00
P2299.7005 humanes LL-37 [LL-37, 37 aa] 
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is...
Peptides and Proteins 196,27
P2301.9505 EBNA-1 Protein (562-570) FMVFLQTHI 
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo...
Peptides and Proteins 85,50
S5340.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) 
Das SARS-CoV Spike (S) Glykoprotein ist für die Bindung des Virus an die Wirtszelle und die Membranfusion zu Beginn des Infektionsprozesses essentiell und...
Peptides and Proteins 995,00
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 225,00
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 995,00
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 995,00
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 225,00
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 225,00
S5345.0050 SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain 
SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus...
Peptides and Proteins 225,00
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 225,00
M3038.0125 Random Hexamer Primer N6 - 5 OD 
Random Hexamers sind kurze Oligodeoxyribonukleotide der zufälligen Sequenz [d(N)6]. Die Primer sind qualitätskontrolliert (MS), gereinigt (HPLC),...
PCR 21,66
M3039.0150 Oligo dT20 Primer 
Oligo(dT)20 Primer (Polydesoxythymidineprimer) werden für die Synthese von cDNA aus mRNA mittels Reverser Transkriptase benutzt. Der Primer hybridisiert mit...
PCR 21,66
M3042.1010 M-MuLV Reverse Transkriptase RNase H negativ 
Need specific and sensitive RT-PCR? The Genaxxon bioscience M-MuLV Reverse Transcriptase, encoded by Moloney Murine Leukemia Virus (M-MuLV RT) and expressed...
PCR 110,14
M3034.0500 RNase Inhibitor - RNasin 
Inhibitor der RNase H, die durch eine Bindung an den Inhibitor im Verhältnis 1:1 inaktiviert wird. Die RNase kann von diesem Komplex reaktiviert werden,...
PCR 76,18
M6081.0500 Steriles Zellkulturwasser 
Sterile water in glass bottles for cell culture or diagnostic use.
PCR 13,55
M3058.0050 HotScriptase RT Cell Mastermix 
RT-PCR (reverse Transkription) direkt aus ganzen Zellen ohne zeitaufwendige und teure RNA-Reinigung oder Zelllyse. PCR direkt aus Körperflüssigkeiten zur...
PCR 35,00
M3023.0000 GreenMasterMix (2X) ohne ROX für die qPCR 
Green qPCR Mastermix ohne ROX optimiert für die qPCR/Realtime PCR in Blockgeräten, speziell von Roche und Qiagen. Der Green qPCR Mastermix ohne ROX enthält...
PCR 20,00
M3045.0000 ProbeMasterMix (2X) No ROX für die qPCR 
PCR Mastermix ohne ROX optimiert für die qPCR (realtime) PCR in Blocksystemen, speziell von Roche und Qiagen Geräten. Der Probe qPCR Mastermix ohne ROX...
PCR 20,00
M3064.0000 HotScriptase Probe RT-qPCR Mastermix ohne ROX 
HotScriptase Probe Mastermix für die RT-qPCR ohne isothermalen Zwischenschritt, dadurch zeit- und kostensparend: HotScriptase Covid-19 Mastermix wurde von...
PCR 20,00
M3068.0020 cDNA One-Step RT-PCR Kit 
Dieser cDNA RT-PCR One-Step Kit ist speziell für hochsensitive und spezifische RT-PCR geeignet. Der Kit enthält eine genetisch veränderte Reverse...
PCR 127,05
M3056.0000 HotScriptase RT Polymerase 
One-Step RT-PCR reverse Transkriptase ohne isothermalen Zwischenschritt, zeit- und kostensparend, mit hoher Thermostabilität
PCR 11,00
M3136.0100 1copy™ COVID-19 qPCR Kit 
1copy™ COVID-19 qPCR Kit is an In-Vitro Diagnostic medical device for qualitative analysis of E gene and RdRp gene for coronavirus (COVID-19) in extracted...
PCR 2550,00
M3138.0050 cDNA One-Step RT-qPCR 2X ProbeMastermix 
Der cDNA One-Step RT-qPCR 2X Mastermix wurde für quantitative real-time-Aalysen von RNA-Templates mit doppelt markierten Fluoreszenz-Probes entwickelt. Die...
PCR 102,25
M3139.0050 PHOENIXDX® 2019-NCOV 
PHOENIXDX® 2019-NCOV is a real-time RT-PCR-based detection system for the 2019 Wuhan coronavirus (2019-nCoV). PHOENIXDX® 2019-NCOV detects the presence of...
PCR 475,00
M3137.0050 cDNA One-Step RT-qPCR 2X GreenMastermix 
Der cDNA One-Step RT-qPCR 2X GreenMastermix wurde für quantitative real-time-Aalysen von RNA-Templates mit doppelt markierten Fluoreszenz-Probes entwickelt....
PCR 102,25
M3141.0125 HotScriptase RT-qPCR COVID-19 CDC Probe Assay Kit 
Der HotScriptase RT-qPCR SARS-CoV-2 CDC Probe Assay Kit wurde bis Mai 2020 für mehr als 2,5 Millionen Coronavirentests (SARS-CoV-2, COVID-19) eingesetzt. Der...
PCR 205,00
QM3039.0150 Oligo dT20 Primer - Angebot 
Oligo(dT)20 Primer (Polydesoxythymidineprimer) werden für die Synthese von cDNA aus mRNA mittels Reverser Transkriptase benutzt. Der Primer hybridisiert mit...
PCR 25,99
M6340.0502 Nuklease und DNA-freies Wasser für die PCR 
Reines, qualitätsgeprüftes, nukleasefreies Wasser eignet sich für alle Experimente, die nukleasefreies Wasser benötigen, einschließlich molekularbiologischer...
PCR 12,88
P2011.0010 No target guide RNA for CRISPR 
Purified gRNA, which has no genomic target in human, rat and mouse. This non-targeting gRNA serves as a tool for establishing non-toxic transfection...
91,25
S5307.0010 Cas9-Nickase-NLS 
Cas9-Nickasen, mutierte Formen des Cas9-Proteins, spalten nur den zu der gRNA komplementären Strang und erzeugen einen Bruch in der doppelsträngigen (ds)DNA....
257,99
1