Hochwertige Produkte
Kundenspezifische Lösungen
Persönlicher Kontakt
Schneller Service
Kompetenter technischer Support +49(0)731-3608-123

humanes LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Vorteile im Überblick

  • Hochwertige Produkte
  • Kundenspezifische Lösungen
  • Persönlicher Kontakt
  • Schneller Service
  • Kompetenter technischer Support +49(0)731-3608-123

Anzahl Stückpreis
Bis 2
284,00 €*
Ab 3
241,40 €*
284,00 €* (15% gespart)
Gewicht
Reinheit
Produktnummer: P2955.9501
Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

Shipment: not cooled. Store at -20°C. For laboratory usage only!
Produktinformationen "humanes LL-37 - scrambled - GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR"

LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.

Amino acid sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Specifications:
Purity: >95% (HPLC)
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
C205H341N61O52
MW = 4493.3 g/mol
Lyophilized white powder


Applikation / Application:
LL-37 is used to study host defense mechanisms.

Einheiten / Units:
Quelle / Source:
synthetic


Sicherheits Hinweise / Safety


Klassifizierungen / Classification

eclass-Nr: 32-16-04-09
Dokumente - Protokolle - Downloads :
Hier finden Sie Informationen und weiterführende Literatur. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.


Dokumente:

Allg. Daten 1
Hier finden Sie Artikel und Literaturzitate, in denen die Autoren auf die hohe Qualität dieses Genaxxonprodukts vertrauen.
Quelle: NCBI PubMed