Hochwertige Produkte
Kundenspezifische Lösungen
Persönlicher Kontakt
Schneller Service
Kompetenter technischer Support +49(0)731-3608-123

SARS-CoV-2 (N-Protein) - Peptid-Pool

Vorteile im Überblick

  • Hochwertige Produkte
  • Kundenspezifische Lösungen
  • Persönlicher Kontakt
  • Schneller Service
  • Kompetenter technischer Support +49(0)731-3608-123

262,65 €*

Produktnummer: P4015.0102
Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

Shipment: not cooled. Store at -20°C. For laboratory usage only!
Produktinformationen "SARS-CoV-2 (N-Protein) - Peptid-Pool"

Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap - UniProt: P0DTC9) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).

Length: 419 amino acids - peptide scan 15/11
Sequence:
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKD
GIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASK
KPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQ
RQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Specifications:
Pool of 102 peptides of Covid-19 N-Protein 
Quantity: approx. 25µg per peptide (2.6mg in total)
Peptides supplied as trifluoro acetate salts
Quality check: by ESI-MS

Protein ID: P0DTC9 (swiss prot)


Applikation / Application:
Einheiten / Units:
Quelle / Source:


Sicherheits Hinweise / Safety


Klassifizierungen / Classification

eclass-Nr: 32-16-04-09
Dokumente - Protokolle - Downloads :
Hier finden Sie Informationen und weiterführende Literatur. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.


Dokumente:

Hier finden Sie Artikel und Literaturzitate, in denen die Autoren auf die hohe Qualität dieses Genaxxonprodukts vertrauen.
Quelle: NCBI PubMed


Dissolve in a minimum amount of pure DMSO (approx. 40μL) and dilute with water to the desired concentration. Please pay attention that the final concentration of DMSO must be below 1% (v/v) to avoid toxicity in the biological assay.