Produkte von Peptides & Elephants

die Peptidexperten

Filter schließen
  •  
  •  
  •  
  •  
 
von bis
  •  
  •  
  •  
  •  
Für die Filterung wurden keine Ergebnisse gefunden!
[Ala9] Autocamtide 2 - KKALRRQEAVDAL
Listenpreis:  195,00 € *   SONDERPREIS:  ab 146,25 € *
[alpha]-Bag Cell Peptide (1 - 7) - APRLRFY
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk...
Listenpreis:  125,00 € *   SONDERPREIS:  ab 100,00 € *
[alpha]-Bag Cell Peptide (1 - 9) - APRLRFYSL
Definition: Bag cell peptides (BCPs) are a class of small neuropeptides secreted by the bag cell neurons in the marine mollusk...
Listenpreis:  125,00 € *   SONDERPREIS:  ab 100,00 € *
3x FLAG Peptid - DYKDDDDK-DYKDDDDK-DYKDDDDK
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die...
Listenpreis:  298,70 € *   SONDERPREIS:  ab 238,96 € *
CMV pp65 (495-503) HLA-A*02:01 NLVPMVATV
Peptidfragment (NLVPMVATV) zur Stimulation von humanen CMV spezifischen CD8+ T-Zellen. Die Peptidsequenz entspricht der vom MHC class I...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
CyLoP-1 Peptid CRWRWKCCKK
CPPs, wie CyloP-1, werden im Allgemeinen von endozytotischen Pfaden aufgenommen wobei die vesikuläre Verkapselung sich als...
Listenpreis:  250,00 € *   SONDERPREIS:  ab 200,00 € *
EBNA-1 Protein (562-570) FMVFLQTHI
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML
Peptidfragment GLCTLVAML zur Stimulation von T-cells, speziell humanen EBV BMLF-1(280-288) CD8+ T-Zellen. Die Peptidsequenz entspricht...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
EBV EBNA-3A (379-387) HLA-B*07:02 RPPIFIRRL
Peptidfragment (RPPIFIRRL) zur Stimulation von humanen EBV EBNA-3A (379-387) spezifischen CD8+ T-Zellen. Die Peptidsequenz entspricht...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
NEU
Epsilon Variante (B.1.427/B.1.429) Peptid Pool...
Peptid pool epsilon Variante B.1.427/B.1.429 (SARS-CoV-2), umfasst 14 Peptide, die alle Mutationen dieser Variante im...
  SONDERPREIS:  262,65 € *
NEU
Eta Variante (B.1.525) Peptid Pool SARS-CoV-2...
Dieser Peptidpool mit 31 Peptiden deckt alle Mutationen im Spike-Glykoprotein ab, die von der Eta-Variante B.1.525 von SARS-CoV-2...
  SONDERPREIS:  262,65 € *
FLAG-Peptid - DYKDDDDK
Das DYKDDDDK-Peptid (Peptidsequenz: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, inklusive einer Enterokinase-Schnittstelle) wurde speziell für die...
Listenpreis:  175,00 € *   SONDERPREIS:  ab 140,00 € *
HBV core (117-125) (HLA-A*24:02) - EYLVSFGVW
Das HBV core (117-125) (HLA-A*24:02) Peptid mit der Sequenz EYLVSFGVW ist ein lineares peptidisches Epitop (Epitop ID15061), das als...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HBV core (18-27) (HLA-A*02:01) - FLPSDFFPSV
Das HBV core (18-27) (HLA-A*02:01) Peptid mit der Sequenz FLPSDFFPSV stell ein lineares Peptid-Epitop dar, das als Teil des...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HBV core (18-27) (subtype ADR4) (HLA-A*02:01) -...
Das HBV core (18-27) (subtype ADR4) (HLA-A*02:01) Peptid mit der Sequenz FLPSDFFPSI ist ein lineares Peptid-Epitop (Epitop ID16832),...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) -...
Das HBV core (19-27) (HLA-B*35:01) (HLA-B*51:01) Peptid mit der Sequenz LPSDFFPSV ist ein lineares peptidisches Epitop (Epitop...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HBV core antigen (88-96) (HLA-A*11:01) - YVNVNMGLK
Das HBV core antigen (88-96) (HLA-A*11:01) Peptid mit der Sequenz YVNVNMGLK ist ein lineares peptidisches Epitop (Epitop ID76370), das...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HBV envelope (183-191) (HLA-A*02:01) - FLLTRILTI
Das HBV envelope (183-191) (HLA-A*02:01) Peptid mit der Sequenz: FLLTRILTI stellt ein Peptidepitop dar (Epitop ID16755), das als Teil...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HCV NS5B (2594-2602) HLA-A*02:01 ALYDVVTKL
T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch MHC-Moleküle präsentiert. Diese T-Zell-Epitope sind...
Listenpreis:  149,35 € *   SONDERPREIS:  ab 119,48 € *
HIV TAT (48-60) GRKKRRQRRRPPQ-NH2 (Amid)
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen...
Listenpreis:  165,00 € *   SONDERPREIS:  ab 132,00 € *
HIV-1 p17 Gag (77-85) HLA-A*02:01 SLYNTVATL
HIV-1 p17 Gag (77-85) - SLYNTVATL gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
HIV-1 RT (476-484) HLA-A*02:01 ILKEPVHGV
Die Sequenz ILKEPVHGV ist Teil des Gag-Pol-Polyproteins aus dem Humanen Immunschwächevirus 1. Das Peptid wurde für Studien zu HIV-1 und...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HIV Pol HLA-A*02:01 VIYHYVDDL
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
HIV-1 TAT (47-57) YGRKKRRQRRR-NH2 (Amid)
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen...
Listenpreis:  160,00 € *   SONDERPREIS:  ab 128,00 € *
HPV 16 E7 (49-57) H-2 Db RAHYNIVTF
RAHYNIVTF entspricht dem linearen Epitop, das als Teil von Protein E7 (Alphapapillomavirus 9) und anderen...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 108,75 € *
humanes LL-37...
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and...
Listenpreis:  306,43 € *   SONDERPREIS:  ab 245,14 € *
Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL
Influenza A MP (58-66) HLA-A*02:01 GILGFVFTL T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
Influenza A NP (366-374) H-2 Db ASNENMETM
Influenza A NP (366-374) H-2 Db ASNENMETM. T-Zell-Epitope werden auf der Oberfläche von Antigen-präsentierenden Zellen durch...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
LCMV GP (33-41) KAVYNFATM
LCMV GP (33-41) mit der Peptidsequenz KAVYNFATM ist ein T-Zell-Epitop-Peptid, das auf der Oberfläche von Antigen-präsentierenden Zellen...
Listenpreis:  149,35 € *   SONDERPREIS:  ab 119,48 € *
MAGE-A3 (271-279) HLA-A*02:01 FLWGPRALV
MAGE-A3 (271-279) FLWGPRALV Antigen gehört zu den T-Zell-Epitop-Peptiden. T-Zell-Epitope werden auf der Oberfläche von...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
MBP (1-11) Human - Ac-ASQKRPSQRHG
MBP (1-11) Human - Ac-ASQKRPSQRHG repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
MBP (54-72) Human - SHHAARTTHYGSLPQKSQR
MBP (54-72) Human - SHHAARTTHYGSLPQKSQR repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der...
Listenpreis:  290,00 € *   SONDERPREIS:  ab 232,00 € *
Melan-A / MART-1 (26-35) - EAAGIGILTV - A*02:01
Melan-A / MART-1 (26-35) - EAAGIGILTV HLA Typ A*02:01 gehört zur Gruppe der T-Zell-Epitop-Peptide. T-Zell-Epitope werden auf der...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
[Ala13] Apelin QRPRLSHKGPMPA
Apelin (auch als APLN bekannt) ist ein Peptid, das beim Menschen vom APLN-Gen kodiert wird. Es ist in verschiedenen Organen wie Herz,...
Listenpreis:  175,00 € *   SONDERPREIS:  ab 140,00 € *
MOG (183-191) - FVIVPVLGP
MOG (183-191) FVIVPVLGP repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide sind...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
MOG (35-55) Human MEVGWYRPPFSRVVHLYRNGK
In wissenschaftlichen Experimenten induziert das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55)...
Listenpreis:  216,30 € *   SONDERPREIS:  ab 173,04 € *
MOG (35-55) Ratte/Maus MEVGWYRSPFSRVVHLYRNGK
In wissenschaftlichen Experimenten induziert das MOG Peptidfragment 35-55 (Myelin Oligodendrocyte Glycoprotein Peptide Fragment 35-55)...
Listenpreis:  210,00 € *   SONDERPREIS:  ab 168,00 € *
MOG (91-108) rat SDEGGYTCFFRDHSYQEE
MOG (91-108) SDEGGYTCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der...
Listenpreis:  290,00 € *   SONDERPREIS:  ab 232,00 € *
MOG (92-106) DEGGYTCFFRDHSYQ
MOG (92-106) DEGGYTCFFRDHSYQ repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide...
Listenpreis:  210,00 € *   SONDERPREIS:  ab 168,00 € *
MOG (97-108) TCFFRDHSYQEE
MOG (97-108) TCFFRDHSYQEE repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der Myelinscheide...
Listenpreis:  210,00 € *   SONDERPREIS:  ab 168,00 € *
Nona-Arginin - Arg9 (R9)
Zellpenetrierende Peptide (CPPs) sind durch ihre Fähigkeit gekennzeichnet, die rezeptorunabhängige Aufnahme von membranundurchlässigen...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
Ova (257-264) SIINFEKL
Ova (257-264) - SIINFEKL gehört zu den T-Zell-Epitop-Peptiden.Ovalbumin (257-264) aus Huhn wird benutzt um die T-Zell. T-Zell-Epitope...
Listenpreis:  149,35 € *   SONDERPREIS:  ab 119,48 € *
Ova (323-339) ISQAVHAAHAEINEAGR
Ova (323-339) ISQAVHAAHAEINEAGR gehört zu den T-Zell-Epitop-Peptiden. Das OVA 323-339 Peptidepitop wird spezifisch von MHC-II Komplexen...
Listenpreis:  180,25 € *   SONDERPREIS:  ab 144,20 € *
CMV IE-1 (316-324) HLA-A*0201 VLEETSVML
CMV IE-1 (316-324) HLA-A*0201 VLEETSVML zur Stimulation von T-Zellen. Das Peptid wurde so synthetisiert, wie es von...
Listenpreis:  145,00 € *   SONDERPREIS:  ab 116,00 € *
PADRE - AKFVAAWTLKAAA
Das pan-HLA-DR-bindende Epitop (PADRE - Peptid AKFVAAWTLKAAA) wurde als ein einfaches Epitoppeptid vorgeschlagen, das für die...
Listenpreis:  180,25 € *   SONDERPREIS:  ab 144,20 € *
PLP (139-151) HCLGKWLGHPDKF
PLP (139 - 151) - HCLGKWLGHPDKF repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der...
Listenpreis:  190,55 € *   SONDERPREIS:  ab 152,44 € *
PLP (178-191) NTWTTCQSIAFPSK
PLP (178-191) - NTWTTCQSIAFPSK repräsentiert eine kurze Peptidsequenz des Proteinlipidteils der Myelinscheide. Proteine der...
Listenpreis:  185,00 € *   SONDERPREIS:  ab 148,00 € *
NEU
SARS-CoV-2 (N-Protein) - Peptid-Pool
Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers...
  SONDERPREIS:  262,65 € *
SARS-CoV-2 (Spike Glycoprotein) Peptide Pool -...
SARS-CoV-2 (Spike Glycoprotein) Peptide Pool of 316 overlapping peptides (delivered in two subpools of 158 & 158 peptides) derived from...
Listenpreis:  592,25 € *   SONDERPREIS:  473,80 € *
NEU
Variant B.1.617.1 (Kappa ) Peptide Pool...
This peptide pool with 25 peptides covers all mutations in the Spike Glycoprotein derived from the kappa variant B.1.617.1 of...
  SONDERPREIS:  262,65 € *
NEU
Variante Omicron B.1.1.529 BA.5 Peptid Pool...
Dieser Peptidpool der Omicron-Variante B.1.1.529 BA.5 von SARS-CoV-2 (315 Peptide, aufgeteilt in zwei Subpools von 158 und 157...
  SONDERPREIS:  826,58 € *
NEU
Variante Omicron B.1.1.529 Peptid Pool...
Dieser SARS-CoV-2 Omicron Variante B.1.1.529 Peptidpool deckt mit 80 Peptiden alle Mutationen im Spike-Glykoprotein ab. Die Peptide...
  SONDERPREIS:  283,25 € *
NEU
Variante Omicron B.1.1.529 Peptid Pool...
Dieser Peptidpool der Omicron-Variante von SARS-CoV-2 (315 Peptide, aufgeteilt in zwei Subpools von 158 und 157 Peptiden) umfasst das...
  SONDERPREIS:  826,58 € *