Peptide und rekominante Proteine für Ihre COVID-19-Forschung finden Sie hier!

Wir bieten SARS Spike Peptide und Proteine für vielfältige Forschungsrichtungen wie der Entwicklung von Impfstoffen und Therapeutika gegen SARS-CoV-2:
Bei Genaxxon erhalten Sie SARS-CoV-2 (2019-nCoV) Spike-Proteine mit diversen wichtigen Sequenzabschnitten.
Das Spike (S)-Glykoprotein enthält S1- und S2-Untereinheiten, die zu Beginn eines Infektionsprozesses die Bindung an und die Fusion mit dem menschlichen ACE2-Transmembranprotein vermitteln, das vom Virus als Eintrittspunkt in die menschliche Wirtszelle verwendet wird.

ACE2 wird im gesamten menschlichen Körper weit verbreitet exprimiert (z.B. in Zungenepithelien, B-Zellen, T-Zellen und Makrophagen in der Mundschleimhaut, Typ-II-Alveolarzellen und Myokardiozyten). Da das S-Glykoprotein für die Erkennung, Bindung und den Eintritt von ACE2-Rezeptoren in Wirtszellen essentiell ist, ist es lein logisches antigenes Ziel für die Entwicklung eines SARS-CoV-2-Impfstoffes und von Therapeutika bei der COVID-19-Behandlung.
Xu et al. "High expression of ACE2 receptor of 2019-nCoV on the epithelial cells of oral mucosa". Int J Oral Sci  12, 8 (2020). https://doi.org/10.1038/s41368-020-0074-x.

- SARS-CoV-2 (2019-nCoV) Spike S1 und S2 Proteine, RBD
- SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic
- Coronavirus 2019 Nucleocapsid Mosaic Protein

In der folgenden Liste können Sie dasjenige SARS Spike-Protein auszuwählen, das für Ihre Forschung am besten geeignet ist.

Eine Übersicht über unsere COVID-19-Produkte finden Sie hier >

Peptide und rekominante Proteine für Ihre COVID-19-Forschung finden Sie hier! Wir bieten SARS Spike Peptide und Proteine für vielfältige Forschungsrichtungen wie der Entwicklung von... mehr erfahren »
Fenster schließen

Peptide und rekominante Proteine für Ihre COVID-19-Forschung finden Sie hier!

Wir bieten SARS Spike Peptide und Proteine für vielfältige Forschungsrichtungen wie der Entwicklung von Impfstoffen und Therapeutika gegen SARS-CoV-2:
Bei Genaxxon erhalten Sie SARS-CoV-2 (2019-nCoV) Spike-Proteine mit diversen wichtigen Sequenzabschnitten.
Das Spike (S)-Glykoprotein enthält S1- und S2-Untereinheiten, die zu Beginn eines Infektionsprozesses die Bindung an und die Fusion mit dem menschlichen ACE2-Transmembranprotein vermitteln, das vom Virus als Eintrittspunkt in die menschliche Wirtszelle verwendet wird.

ACE2 wird im gesamten menschlichen Körper weit verbreitet exprimiert (z.B. in Zungenepithelien, B-Zellen, T-Zellen und Makrophagen in der Mundschleimhaut, Typ-II-Alveolarzellen und Myokardiozyten). Da das S-Glykoprotein für die Erkennung, Bindung und den Eintritt von ACE2-Rezeptoren in Wirtszellen essentiell ist, ist es lein logisches antigenes Ziel für die Entwicklung eines SARS-CoV-2-Impfstoffes und von Therapeutika bei der COVID-19-Behandlung.
Xu et al. "High expression of ACE2 receptor of 2019-nCoV on the epithelial cells of oral mucosa". Int J Oral Sci  12, 8 (2020). https://doi.org/10.1038/s41368-020-0074-x.

- SARS-CoV-2 (2019-nCoV) Spike S1 und S2 Proteine, RBD
- SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic
- Coronavirus 2019 Nucleocapsid Mosaic Protein

In der folgenden Liste können Sie dasjenige SARS Spike-Protein auszuwählen, das für Ihre Forschung am besten geeignet ist.

Eine Übersicht über unsere COVID-19-Produkte finden Sie hier >

Filter schließen
 
  •  
von bis
Für die Filterung wurden keine Ergebnisse gefunden!
Prod.Nr. Description     Price €
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 225,00
P2301.9505 EBNA-1 Protein (562-570) FMVFLQTHI 
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo...
Peptides and Proteins 85,50
P2299.7005 humanes LL-37 [LL-37, 37 aa] 
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is...
Peptides and Proteins 196,27
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g) 
Recombinant Human IFN-g wird in E.Coli als nicht-glykosyliertes Polypeptid aus 144 Aminosäuren und einer molaren Masse von 16.879 Dalton hergestellt....
Peptides and Proteins 145,00
S5340.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) 
Das SARS-CoV Spike (S) Glykoprotein ist für die Bindung des Virus an die Wirtszelle und die Membranfusion zu Beginn des Infektionsprozesses essentiell und...
Peptides and Proteins 995,00
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 225,00
S5345.0050 SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain 
SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus...
Peptides and Proteins 225,00
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 225,00
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 225,00
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 995,00
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 995,00
1