Peptide und rekominante Proteine für Ihre COVID-19-Forschung finden Sie hier!

Wir bieten SARS Spike Peptide und Proteine für vielfältige Forschungsrichtungen wie der Entwicklung von Impfstoffen und Therapeutika gegen SARS-CoV-2:
Bei Genaxxon erhalten Sie SARS-CoV-2 (2019-nCoV) Spike-Proteine mit diversen wichtigen Sequenzabschnitten.
Das Spike (S)-Glykoprotein enthält S1- und S2-Untereinheiten, die zu Beginn eines Infektionsprozesses die Bindung an und die Fusion mit dem menschlichen ACE2-Transmembranprotein vermitteln, das vom Virus als Eintrittspunkt in die menschliche Wirtszelle verwendet wird.

ACE2 wird im gesamten menschlichen Körper weit verbreitet exprimiert (z.B. in Zungenepithelien, B-Zellen, T-Zellen und Makrophagen in der Mundschleimhaut, Typ-II-Alveolarzellen und Myokardiozyten). Da das S-Glykoprotein für die Erkennung, Bindung und den Eintritt von ACE2-Rezeptoren in Wirtszellen essentiell ist, ist es lein logisches antigenes Ziel für die Entwicklung eines SARS-CoV-2-Impfstoffes und von Therapeutika bei der COVID-19-Behandlung.
Xu et al. "High expression of ACE2 receptor of 2019-nCoV on the epithelial cells of oral mucosa". Int J Oral Sci  12, 8 (2020).

- SARS-CoV-2 (2019-nCoV) Spike S1 und S2 Proteine, RBD
- SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic
- Coronavirus 2019 Nucleocapsid Mosaic Protein

In der folgenden Liste können Sie dasjenige SARS Spike-Protein auszuwählen, das für Ihre Forschung am besten geeignet ist.

Eine Übersicht über unsere COVID-19-Produkte finden Sie hier >

Peptide und rekominante Proteine für Ihre COVID-19-Forschung finden Sie hier! Wir bieten SARS Spike Peptide und Proteine für vielfältige Forschungsrichtungen wie der Entwicklung von... mehr erfahren »
Fenster schließen

Peptide und rekominante Proteine für Ihre COVID-19-Forschung finden Sie hier!

Wir bieten SARS Spike Peptide und Proteine für vielfältige Forschungsrichtungen wie der Entwicklung von Impfstoffen und Therapeutika gegen SARS-CoV-2:
Bei Genaxxon erhalten Sie SARS-CoV-2 (2019-nCoV) Spike-Proteine mit diversen wichtigen Sequenzabschnitten.
Das Spike (S)-Glykoprotein enthält S1- und S2-Untereinheiten, die zu Beginn eines Infektionsprozesses die Bindung an und die Fusion mit dem menschlichen ACE2-Transmembranprotein vermitteln, das vom Virus als Eintrittspunkt in die menschliche Wirtszelle verwendet wird.

ACE2 wird im gesamten menschlichen Körper weit verbreitet exprimiert (z.B. in Zungenepithelien, B-Zellen, T-Zellen und Makrophagen in der Mundschleimhaut, Typ-II-Alveolarzellen und Myokardiozyten). Da das S-Glykoprotein für die Erkennung, Bindung und den Eintritt von ACE2-Rezeptoren in Wirtszellen essentiell ist, ist es lein logisches antigenes Ziel für die Entwicklung eines SARS-CoV-2-Impfstoffes und von Therapeutika bei der COVID-19-Behandlung.
Xu et al. "High expression of ACE2 receptor of 2019-nCoV on the epithelial cells of oral mucosa". Int J Oral Sci  12, 8 (2020).

- SARS-CoV-2 (2019-nCoV) Spike S1 und S2 Proteine, RBD
- SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic
- Coronavirus 2019 Nucleocapsid Mosaic Protein

In der folgenden Liste können Sie dasjenige SARS Spike-Protein auszuwählen, das für Ihre Forschung am besten geeignet ist.

Eine Übersicht über unsere COVID-19-Produkte finden Sie hier >

Filter schließen
von bis
Für die Filterung wurden keine Ergebnisse gefunden!
Prod.Nr. Description     Price €
P2301.9505 EBNA-1 Protein (562-570) FMVFLQTHI 
The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo...
Peptides and Proteins 85,50
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is...
Peptides and Proteins 174,25
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g) 
Recombinant Human IFN-g wird in E.Coli als nicht-glykosyliertes Polypeptid aus 144 Aminosäuren und einer molaren Masse von 16.879 Dalton hergestellt....
Peptides and Proteins 145,00
S5340.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein (RBD) 
Das SARS-CoV Spike (S) Glykoprotein ist für die Bindung des Virus an die Wirtszelle und die Membranfusion zu Beginn des Infektionsprozesses essentiell und...
Peptides and Proteins 995,00
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 225,00
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 995,00
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 995,00
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 225,00
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 225,00
S5345.0050 SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain 
SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus...
Peptides and Proteins 225,00
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 225,00
S5344.0100 human ACE2 Protein (ECD), Avi/His-Tag, nonbiotinylated 
The protein contains an Avi-Tag and is ready for invitro biotinylation. The human Angiotensin-Converting Enzyme 2 (ACE-2) is a protein highly expressed at...
Peptides and Proteins 650,00