Suche
Filter schließen
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
 
von bis
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
1 von 4
Für die Filterung wurden keine Ergebnisse gefunden!
Agarose Tiny - low melting, high resolution Agarose Tiny, niedrig schmelzende Agarose
85,08 € * ab 56,72 € *
Agarose Tiny HT von Genaxxon Agarose Tiny HT
ab 91,68 € *
Agarose Mega Agarose Mega
ab 79,77 € *
PHC-SKKKK PHC-SKKKK
235,20 € *
Lipopeptide Pam3CysSSNAKIDQLSSDVQT Pam3CysSSNAKIDQLSSDVQT
522,06 € *
Lipopeptide Pam3CysSSNKSTTGSGETTTA Pam3CysSSNKSTTGSGETTTA
522,06 € *
Lipopeptide Pam3CysSSTKPVSQDTSPKPA Pam3CysSSTKPVSQDTSPKPA
522,06 € *
Lipopeptide Pam3CysSSGSKPSGGPLPDAK Pam3CysSSGSKPSGGPLPDAK
522,06 € *
Lipopeptide Pam3CysSSGNKSAPSSSASSS Pam3CysSSGNKSAPSSSASSS
522,06 € *
Pam3CysGSHQMKSEGHANMQL Pam3CysGSHQMKSEGHANMQL
522,06 € *
Pam3CysSSSNNDAAGNGAAQT Pam3CysSSSNNDAAGNGAAQT
522,06 € *
Pam3CysKQNVSSLDEKNSVSV Pam3CysKQNVSSLDEKNSVSV
522,06 € *
Pam3CysNNSGKDGNTSANSAD Pam3CysNNSGKDGNTSANSAD
522,06 € *
Pam3CysNNGGPELKSDEVAKS Pam3CysNNGGPELKSDEVAKS
522,06 € *
Pam3CysSQEPAAPAAEATPAG Pam3CysSQEPAAPAAEATPAG
522,06 € *
Pam3CysSSSKSSDSSAPKAYG Pam3CysSSSKSSDSSAPKAYG
516,32 € *
Pam3CysAQEKEAKSELDYDQT Pam3CysAQEKEAKSELDYDQT
533,53 € *
Lipopeptide Pam2Cys-SKKKK Pam2Cys-SKKKK
ab 166,37 € *
FSL-1 TLR2/TLR6 Agonist FSL-1 TLR2/TLR6 Agonist
510,58 € *
FSL-1 FLAG-tag TLR2/TLR6 Agonist FSL-1 FLAG-tag TLR2/TLR6 Agonist
ab 258,16 € *
Lipopeptid Pam-Dhc-SKKKK Lipopeptid Pam-Dhc-SKKKK
235,20 € *
Lipopeptid Pam-Dhc-GDPKHPKSF Lipopeptid Pam-Dhc-GDPKHPKSF
355,68 € *
Lipopeptid PamCSKKKK Lipopeptid PamCSKKKK
235,20 € *
Lipopeptide PamCGDPKHPKSF Lipopeptide PamCGDPKHPKSF
384,37 € *
Lipopeptid Dhc-SKKKK Lipopeptid Dhc-SKKKK
212,26 € *
Lipopeptid Dhc-GDPKHPKSF Lipopeptid Dhc-GDPKHPKSF
323,87 € *
Lipopeptid SKKKK Lipopeptid SKKKK
223,74 € *
Lipopeptid GDPKHPKSF Lipopeptid GDPKHPKSF
323,87 € *
Amyloid-beta (1-40) Ratte Amyloid-beta (1-40) Ratte
ab 272,92 € *
Amyloid-beta (1-40) Ratte (HCl Salz) Amyloid-beta (1-40) Ratte (HCl Salz)
ab 418,40 € *
Amyloid-beta (1-40). human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Amyloid-beta (1-40). human...
ab 253,11 € *
Amyloid-beta (1-40) human (HCl Salz) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Amyloid-beta (1-40) human (HCl Salz)...
ab 418,40 € *
Kontrollpeptid Amyloid-beta (40-1) Ratte Kontrollpeptid Amyloid-beta (40-1) Ratte
ab 253,11 € *
Kontrollpeptid Amyloid-beta (40-1) human Kontrollpeptid Amyloid-beta (40-1) human
ab 253,11 € *
Biotinyliertes Amyloid-beta (1-40) Ratte Biotinyliertes Amyloid-beta (1-40) Ratte
ab 495,24 € *
Biotinyliertes Amyloid-beta (1-40) human Biotinyliertes Amyloid-beta (1-40) human
ab 495,24 € *
qshyrhispaqv (D-Aminosäuren) qshyrhispaqv (D-Aminosäuren)
ab 207,66 € *
FYLKVPSSLHHHHGRDKLVFFHHHH FYLKVPSSLHHHHGRDKLVFFHHHH
ab 207,66 € *
Alzheimer Peptide NYSKMIFSHHHH Peptid: NYSKMIFSHHHH
ab 158,70 € *
Amyloid inhibitor peptide - HNHKLVFFHHQH Amyloid inhibitor peptide - HNHKLVFFHHQH
ab 158,70 € *
Taq Polymerase from Genaxxon Taq DNA-Polymerase S (Hohe Genauigkeit)
ab 50,00 € *
Pwo DNA Polymerase from Genaxxon Pwo proofreading Polymerase
ab 35,00 € *
ReproFast DNA Polymerase from Genaxxon ReproFast proofreading Polymerase
ab 42,00 € *
Pfu DNA Polymerase from Genaxxon Pfu proofreading Polymerase
ab 75,00 € *
KOD Polymerase from Genaxxon ReproHot proofreading Polymerase
ab 109,50 € *
Taq Polymerase from Genaxxon Taq DNA-Polymerase E (Hohe Ausbeute)
ab 50,00 € *
DNA free Taq Polymerase from Genaxxon DF Taq DNA-Polymerase S (DNA-frei)
ab 74,35 € *
Hotstart Taq from Genaxxon HotStart Taq DNA-Polymerase - Aptamer inhibiert
ab 70,00 € *
Hotstart Taq from Genaxxon SuperHot Taq DNA-Polymerase - chemisch...
90,00 € * ab 63,00 € *
Hotstart PCR Mastermixes from Genaxxon SuperHot Taq PCR Kit mit dNTP-Mix für HotStart PCR
ab 90,00 € *
10X PCR Buffer S incomplete - 1mL 10X PCR Buffer S incomplete - 1mL
5,00 € *
10X PCR Buffer S complete - 1mL 10X PCR Buffer S complete - 1mL
5,00 € *
10X PCR Buffer E incomplete - 1mL 10X PCR Buffer E incomplete - 1mL
5,00 € *
10X PCR Buffer E complete - 1mL 10X PCR Buffer E complete - 1mL
5,00 € *
10-fach PCR Puffer - custom made 10-fach PCR Puffer - custom made
ab 192,95 € *
B-Enhancer Lösung B-Enhancer Lösung
ab 12,05 € *
random Hexamer N6 Primer 5OD (160µg) Random Hexamer Primer N6
28,88 € * ab 21,66 € *
M-MuLV Reverse Transkriptase RNase H negativ M-MuLV Reverse Transkriptase RNase H negativ
ab 119,12 € *
UDG - Uracil DNA Glycosylase Uracil-DNA Glycosylase (UDG)
ab 84,08 € *
Loading Dye with Bromophenol blue DNA Ladepuffer I
ab 22,05 € *
Loading Dye with Orange G DNA Ladepuffer II mit Orange G
ab 22,05 € *
GENAXXON bioscience dNTP-Mix (Na-salt) - 10 mM dNTP-Mix (Na-salz) - 10 mM
20,00 € * ab 15,00 € *
ready-to-use dNTP-Mix (Na-salz) - 2 mM ready-to-use dNTP-Mix (Na-salz) - 2 mM
ab 25,00 € *
2'-Deoxyadenosine 5'-triphosphate - dATP dATP (2'-Deoxyadenosin 5'-triphosphat) Lösung -...
ab 45,00 € *
2'-Deoxycytidine 5'-triphosphate - dCTP dCTP (2'-Deoxycytosin 5'-triphosphat) Lösung -...
ab 45,00 € *
2'-Deoxyguanosine 5'-triphosphate - dGTP dGTP (2'-Deoxyguanosin 5'-triphosphat) Lösung -...
ab 45,00 € *
2'-Deoxythymidine 5'-triphosphate - dTTP dTTP (2'-Deoxythymidin 5'-triphosphat) Lösung -...
ab 45,00 € *
dUTP Lösung 100mM dUTP Lösung 100mM
ab 45,24 € *
7-deaza-dGTP, min. 96% (50mM) 7-deaza-dGTP, min. 96% (50mM)
371,84 € *
Aminoallyl-dUTP, min. 98% (10mM) Aminoallyl-dUTP, min. 98% (10mM)
60,84 € *
Flu-12-dUTP, min. 96% (1mM) Flu-12-dUTP, min. 96% (1mM)
304,22 € *
Biotin-11-dUTP Lösung, min. 96% (1mM) Biotin-11-dUTP Lösung, min. 96% (1mM)
ab 253,18 € *
DNase I (EC 3.1.21.1) DNase I (EC 3.1.21.1)
ab 34,94 € *
RNase A - Ribonuclease Ribonuklease A (RNase A)
ab 53,43 € *
Proteinase K Lösung (20 mg/mL) - PCR tauglich Proteinase K Lösung (20 mg/mL) - PCR tauglich
ab 10,50 € *
Plasmid-DNA Reinigungssäulchen mit Deckel Plasmid-DNA Reinigungssäulchen mit Deckel
44,32 € *
Keramische Beads zur Zelllyse Keramische Beads zur Zelllyse
ab 200,85 € *
RNA purification columns for isolation of RNA from different samples RNA Mini Spin Reinigungssäulchen
71,92 € *
CentriPure P100 protein purification columns CentriPure P100 Säulchen für die Reinigung von...
ab 55,50 € *
CentriPure Z25 Mini Spin columns CentriPure Z25 Mini Spin columns
ab 25,00 € *
Glutathion Agarose Glutathion Agarose
ab 222,20 € *
Rho1D4 Agarose Rho1D4 Agarose
ab 370,12 € *
Rho1D4 Peptid Rho1D4 Peptid
ab 209,70 € *
Rho1D4 Starterset Rho1D4 Starterset
288,34 € *
Rho1D4 / Anti-Rhodopsin Antibody Rho1D4 / Anti-Rhodopsin Antibody
452,79 € *
Ni-IDA MagBeads für His-tagged Proteinreinigung Ni-IDA MagBeads für His-tagged Proteinreinigung
ab 67,52 € *
Ni-NTA MagBeads Ni-NTA MagBeads für die His-tagged...
ab 97,20 € *
Co-NTA MagBeads His-tagged Proteinreinigung Co-NTA MagBeads His-tagged Proteinreinigung
ab 108,01 € *
Glutathione Magnetic Beads Glutathione Magnetic Beads
ab 88,81 € *
Rho1D4 MagBeads Rho1D4 MagBeads
ab 423,21 € *
Ni-IDA, Co-IDA Agarose Ni-IDA Agarose für His-tagged Proteine
ab 123,81 € *
Ni-NTA Agarose für His-tagged Proteine Ni-NTA Agarose für His-tagged Proteine
ab 179,85 € *
Co-NTA Agarose für His-tagged Proteine Co-NTA Agarose für His-tagged Proteine
ab 215,99 € *
gefüllte Ni-IDA Agarose Säulchen gefüllte Ni-IDA Agarose Säulchen
ab 337,02 € *
Mini spin columns for affinity purification Spin-columns Leersäulchen 0,5mL für...
ab 148,74 € *
Protein L-Ligand Leakage Elisa Kit Protein L-Ligand Leakage Elisa Kit
1.477,60 € *
Protein L-Ligand Leakage Elisa XL Protein L-Ligand Leakage Elisa XL
1.729,88 € *
Xylene Cyanol C.I. 42135 Xylolcyanol FF
ab 82,42 € *
Amidoschwarz 10B Amidoschwarz 10B
ab 52,25 € *
Ponceau S staining dye Ponceau S (C.I. 27195)
ab 42,57 € *
Ponceau S (C.I. 27195) Ponceau S Lösung
ab 31,67 € *
Methylenblau (C.I. 52015) Methylenblau (C.I. 52015)
ab 44,86 € *
Methylgrün (C.I. 42590) Methylgrün (C.I. 42590)
ab 48,36 € *
Cresol red chemical structure Kresolrot
ab 36,14 € *
Fast Green - chemical structure Fast Green FCF (C.I. 42053)
ab 41,47 € *
Trypan Blue (C.I. 23850) Trypanblau (C.I. 23850)
ab 39,03 € *
GelRed® in Wasser - Nucleic acid stain GelRed® in Wasser - Nucleic acid stain
ab 250,00 € *
ethidium bromide 0.07% solution 0,07 % Ethidiumbromidlösung
ab 58,93 € *
DAPI - 4',6-Diamidino-2-phenylindole dihydrochloride DAPI - 4',6-Diamidino-2-phenylindol...
ab 91,75 € *
Orange G (C.I. 16230), Acid Orange 10; Wool Orange 2G Orange G (C.I. 16230)
ab 40,69 € *
TIPP!
Propidium iodide chemical structure HighPure Propidiumiodid
ab 49,98 € *
Potassium tetrathionate Kaliumtetrathionat (min. 99%)
ab 275,50 € *
Amoxicillin trihydrate Amoxicillin Trihydrat
ab 87,00 € *
Amphotericin B - chemical structure Amphotericin B Pulver
ab 59,85 € *
Amphotericin B Solution from Genaxxon Amphotericin B Lösung 100X
ab 28,46 € *
Bacitracin chemical structure Bacitracinpulver, 55 000 U/g
ab 64,20 € *
Bleomycinsulfat, lyophilisiert Bleomycinsulfat, lyophilisiert
ab 162,17 € *
Gentamicin sulfate Gentamycinsulfat Pulver - p.A.
ab 42,00 € *
Gentamicin sulfate Gentamycinsulfat - 10 mg/mL
ab 55,00 € *
Hygromycin Hygromycin B Lösung - 50mg/mL
205,79 € *
Kanamycinsulfatlösung mit 5 mg/mL Kanamycinsulfatlösung mit 5 mg/mL
ab 64,10 € *
Kanamycinsulfat 50 mg/mL Kanamycinsulfat 50 mg/mL
ab 261,63 € *
Penicillin-Streptomycin (10000 U/mL) Penicillin-Streptomycin (10000 U/mL)
ab 16,39 € *
Antibiotic Antimycotic Solution (100X) Antibiotic Antimycotic Solution (100X)
ab 29,76 € *
Zeocin™ Zeocin™
ab 164,60 € *
BCIP für die Molekularbiologie BCIP für die Molekularbiologie
ab 73,97 € *
IPTG, dioxanfrei, Molbio Grade IPTG, dioxanfrei, Molbio Grade
280,00 € * ab 154,00 € *
ready-to-use IPTG solution - 10 x 1 mL ready-to-use IPTG solution - 10 x 1 mL
363,10 € *
Naphthol-AS-BI-phosphat chemical structure Naphthol-AS-BI-phosphat
ab 61,14 € *
Naphthol-AS-D-chloroacetat Naphthol-AS-D-chloroacetat
ab 64,85 € *
X-alpha Gal X-alpha-D-Gal / 5-Brom-4-chlor-3-indolyl...
ab 315,00 € *
Rose-Gal, Red-Gal, Salmon-Gal, Rose-Gal / 6-Chloro-3-indolyl-b-D-galactopyranosid Rose-Gal / 6-Chloro-3-indolyl-b-D-galactopyranosid
ab 155,56 € *
4-Chloro-1-Naphthol 4-Chloro-1-Naphthol (min. 99,0% HPLC)
ab 96,83 € *
3,3'5,5'-Tetramethylbenzidin (TMB) 3,3'5,5'-Tetramethylbenzidin (TMB)
ab 154,09 € *
EC Blue(TM) Enhanced Substrate - TMB TMB ready-to-use solution
ab 115,61 € *
Diaminobezidine tetrahydrochloride 3,3'-Diaminobenzidin Tetrahydrochlorid
ab 29,24 € *
4-Nitrophenyl a-L-fucopyranosid - min. 99% 4-Nitrophenyl a-L-fucopyranosid - min. 99%
ab 208,39 € *
4-Nitrophenyl a-L-manopyranosid - min. 99% 4-Nitrophenyl a-L-manopyranosid - min. 99%
ab 291,78 € *
4-Nitrophenyl ß-D-xylopyranosid - min. 99% 4-Nitrophenyl ß-D-xylopyranosid - min. 99%
ab 175,07 € *
4-Nitrophenyl-2-acetamido-2-deoxy-b-D-glucopyranosid (min. 99.0% HPLC) 4-Nitrophenyl-2-acetamido-2-deoxy-b-D-glucopyra...
ab 183,01 € *
beta-Nicotinamide adenine dinucleotide β-Nicotinamidadenindinukleotid - β-NAD
ab 61,29 € *
NADH sodium salt NADH Na-Salz (reduziert)
ab 75,00 € *
β-Nicotinamidadenindinucleotidphosphat - NADP Na-Salz β-Nicotinamidadenindinucleotidphosphat - NADP...
ab 66,06 € *
Collagenase Substrate Component A Collagenase-Chromophore-Substrate Component A
407,69 € *
Ficoll(R) 400 - Polysucrose 400 Ficoll(R) 400 - Polysucrose 400
ab 51,85 € *
LEUCO-Human - Zellseparationsmedium LEUCO-Human - Zellseparationsmedium
ab 16,77 € *
LEUCO-Maus - Zellseparationsmedium LEUCO-Maus - Zellseparationsmedium
ab 30,36 € *
c4754 cell separation medium Lympho-Paque - Zellseparationsmedium
19,10 € * ab 15,28 € *
Sodium citrate dihydrate Citronensäure Trinatriumsalz Dihydrat, p.A....
ab 50,55 € *
Hepes for cell culture applications HEPES für die Zellkultur
ab 70,75 € *
CAPS, 3-(Cyclohexylamino)-1-propane, 3-(Cyclohexylamino)-1-propanesulfonic acid CAPS >99% rein - Pufferqualität
ab 75,50 € *
CHAPSO; 3-([3-Cholamidopropyl]dimethylammonio)-2-hydroxy-1-propanesulfonate CHAPSO - min. 98.0% (HPLC)
ab 100,43 € *
HEPES buffer quality HEPES Pufferqualität
ab 50,47 € *
MES wasserfrei. p.A. MES wasserfrei. p.A.
ab 89,41 € *
MES monohydrate; 2-(N-Morpholino)ethanesulfonic acid; 4-Morpholineethanesulfonic acid monohydrate; 2-(4-Morpholinyl)ethanesulfonic acid monohydrate MES Monohydrat Pufferqualität
ab 71,57 € *
PIPES. Ultrarein PIPES. Ultrarein
ab 92,42 € *
Tris chemical structure Tris - Ultrapur (99.9%)
ab 72,02 € *
Tris chemical structure Tris Pufferqualität. min. 99%
ab 60,58 € *
MOPS for biological buffers MOPS p.A.. min. 99.5%
ab 67,74 € *
CHAPS Pufferqualität CHAPS Pufferqualität
ab 89,55 € *
Imidazole chemical structure Imidazol
ab 43,94 € *
Calcium lactate pentahydrate Calciumlactat Pentahydrat
118,97 € *
DMSO - Dimethylsulfoxide DMSO für die Zellkultur
ab 39,91 € *
Dimethylsulfoxid chemicals structure DMSO für die Molekularbiologie
ab 39,91 € *
Dimethylsulfoxid chemical structure DMSO. p.A., min. 90%
ab 36,52 € *
Diethylenglycol chemical structure Diethylenglycol
37,81 € *
Ethylene glycol chemical structure Ethylenglykol reinst, min. 99%
ab 34,05 € *
Uracil, 2,4(1H,3H)-Pyrimidinedione, 2,4-Dihydroxypyrimidine, 2,4-Pyrimidinediol Uracil für die Zellkultur
ab 52,56 € *
Cytosin Cytosin
ab 86,48 € *
Adenosin Adenosin (>99%)
ab 49,55 € *
DTE (für die Molekularbiologie) DTE (für die Molekularbiologie)
ab 78,38 € *
DL-Dithiothreitol DL-Dithiothreitol (DTT) für die Molekularbiologie
ab 62,85 € *
DL-Dithiothreitol DL-Dithiothreitol (DTT) - BioChemica
ab 50,06 € *
Natriumthiosulfat Pentahydrat Natriumthiosulfat Pentahydrat
ab 22,65 € *
Polyethylene glycol 4000 Polyethylenglycol 4000 - PEG 4000
ab 57,00 € *
Polyethylenglycol 6000 - PEG 6000 Polyethylenglycol 6000 - PEG 6000
ab 53,82 € *
Polyethyleneglycol 400 Polyethyleneglycol 400
ab 54,32 € *
Polyethylene glycol 8000 Polyethylenglycol 8000 - PEG 8000
ab 39,50 € *
Octyl b-D-glucopyranoside - chemical structure n-Octyl-ß-D-glucopyranosid (min. 99,0% TLC)
ab 57,87 € *
n-Octyl-ß-D-glucopyranosid für die Kristallographie (min. 99,5% TLC) n-Octyl-ß-D-glucopyranosid für die...
ab 73,82 € *
n-Nonyl ß-D-glucopyranosid (min. 99,0% TLC) n-Nonyl ß-D-glucopyranosid (min. 99,0% TLC)
ab 117,72 € *
n-Decyl-ß-D-glucopyranosid (min. 99,0% TLC) n-Decyl-ß-D-glucopyranosid (min. 99,0% TLC)
ab 99,77 € *
n-Dodecyl-ß-D-glucopyranosid (min. 99,0% TLC) n-Dodecyl-ß-D-glucopyranosid (min. 99,0% TLC)
ab 119,71 € *
n-Nonyl ß-maltopyranosid (NM), min. 99% hochrein n-Nonyl ß-maltopyranosid (NM), min. 99% hochrein
ab 95,00 € *
n-Nonyl ß-maltopyranosid (NM), min. 99,5% für die Kristallographie n-Nonyl ß-maltopyranosid (NM), min. 99,5% für...
ab 101,04 € *
n-Decyl-ß-maltopyranosid (DM), min. 99% n-Decyl-ß-maltopyranosid (DM), min. 99%
ab 103,75 € *
n-Decyl-ß-maltopyranosid (DM), min. 99,5% für die Kristallographie n-Decyl-ß-maltopyranosid (DM), min. 99,5% für...
ab 129,69 € *
n-Undecyl-ß-maltopyranosid, min. 99,0% n-Undecyl-ß-maltopyranosid, min. 99,0%
ab 109,74 € *
n-Dodecyl-ß-maltopyranosid (DDM), min. 99% n-Dodecyl-ß-maltopyranosid (DDM), min. 99%
ab 75,00 € *
n-Dodecyl-ß-maltopyranosid (DDM), min. 99,5% n-Dodecyl-ß-maltopyranosid (DDM), min. 99,5%
ab 75,00 € *
n-Tridecyl-ß-maltopyranosid (TDM), min. 99,5% n-Tridecyl-ß-maltopyranosid (TDM), min. 99,5%
ab 161,16 € *
n-Octyl 1-thio-ß-D-glucopyranosid n-Octyl 1-thio-ß-D-glucopyranosid
ab 59,84 € *
MEGA-8 MEGA-8
ab 49,87 € *
Mega-9; N-Nonanoyl-N-methylglucamine MEGA-9 - N-Nonanoyl-N-methylglucamin
ab 49,87 € *
MEGA-10 MEGA-10
ab 49,87 € *
n-Undecyl-ß-maltosid, min. 99,5% für die Kristallographie n-Undecyl-ß-maltosid, min. 99,5% für die...
ab 137,66 € *
SDS - chemical structure SDS für die Molekularbiologie
ab 37,21 € *
SDS, Molecular Biology grade, 20% Lösung SDS, Molecular Biology grade, 20% Lösung
ab 61,17 € *
5% SDS solution 5%-ige SDS Lösung
ab 14,07 € *
0,25% Trypsin in PBS ohne Mg and Ca 0,25% Trypsin in PBS ohne Mg and Ca
ab 15,91 € *
0,25% Trypsin in PBS, mit 0,02% EDTA 0,25% Trypsin in PBS, mit 0,02% EDTA
ab 13,85 € *
Tryspin/EDTA - 0.05% Trypsin and 0.02% EDTA in PBS 0,05% Trypsin mit 0,02% EDTA in PBS ohne Mg2, Ca2+
ab 14,95 € *
Trypsin EDTA for cell culture 0,05% Trypsin mit 0,1% EDTA in PBS ohne Mg2+,...
ab 16,50 € *
Accutase® Cell Detachment Solution Accutase® Cell Detachment Solution
74,62 € *
EDTA (Versene), 1%, in PBS, ohne Ca2+ und Mg2+ EDTA (Versene), 1%, in PBS, ohne Ca2+ und Mg2+
ab 14,25 € *
Trypsin from porcine pancreas Trypsin aus Schweinepankreas (1:250)
ab 125,12 € *
Collagenase Type I - with a balanced activity of collagenase, clostripain as well as tryptic and proteolytic activities.es. Collagenase Typ I (EC 3.4.24.3) >100 units/mg
114,20 € * ab 79,94 € *
Collagenase Type II - high clostripain activity Collagenase Typ II (EC 3.4.24.3) >180 units/mg
114,20 € * ab 79,94 € *
Collagenase Type III - normal Collagenase, but very low proteolytic activity Collagenase Typ III (EC 3.4.24.3)
1.364,75 € *
Collagenase IV - low tryptic, high collagenase and normal clostripain activity. Collagenase Typ IV (EC 3.4.24.3) >900 units/mg
125,00 € * ab 100,00 € *
Dextransulfat Natriumsalz, 50% Lösung Dextransulfat Natriumsalz, 50% Lösung
ab 155,00 € *
SSC Puffer (20X) Pulver SSC Puffer (20X) Pulver
ab 70,30 € *
SSC Puffer (20X) Lösung - 1L SSC Puffer (20X) Lösung - 1L
63,54 € * ab 57,19 € *
PBS buffer ready-to-use tablets pH7.4 PBS Puffertabletten (pH7,4 - 100 mL) - 100 tablets
83,50 € *
PBS buffer ready-to-use tablets, pH7.4 PBS Puffertabletten (pH7,4 - 500mL)
ab 159,00 € *
PBS Puffertabletten ohne Kalium (pH7,4 - 1L - 0,01M) PBS Puffertabletten ohne Kalium (pH7,4 - 1L -...
ab 85,91 € *
Natriumchloridtabletten (100 mL) - 100 tablets Natriumchloridtabletten (100 mL) - 100 tablets
94,80 € *
ready-to-use sodium chloride tablets for 0.9% solution Natriumchloridtabletten (1 L)
ab 64,70 € *
Borat gepufferte Salztabletten (pH 8,2) - 100 tablets Borat gepufferte Salztabletten (pH 8,2) - 100...
249,81 € *
ready-to-use pNPP tablets for ELISA tests p-Nitrophenylphosphat (5 mg) Tabletten
59,50 € * ab 47,60 € *
p-Nitrophenylphosphat (20 mg) Tabletten p-Nitrophenylphosphat (20 mg) Tabletten
ab 113,00 € *
D(+)Glucose 20% - 5 bags D(+)Glucose 20% - 5 bags
165,74 € *
EDTA Puffer (pH 8,0 - 5 bags) EDTA Puffer (pH 8,0 - 5 bags)
ab 212,72 € *
10-fach PBS Pulver (pH7,4) 10-fach PBS Pulver (pH7,4)
104,00 € *
PBS Pulver (pH 7,4 - 1 bag) PBS Pulver (pH 7,4 - 1 bag)
ab 57,19 € *
Kaliumchlorid (1M) - 10 bags Kaliumchlorid (1M) - 10 bags
176,08 € *
Kaliumchlorid (3M) - 5 bags Kaliumchlorid (3M) - 5 bags
166,23 € *
SSC Puffer (20-fach - pH7,0) - 5 bags SSC Puffer (20-fach - pH7,0) - 5 bags
173,05 € *
SSC Puffer (2-fach - pH7,0) - 5 bags SSC Puffer (2-fach - pH7,0) - 5 bags
114,24 € *
gepufferte Natriumcitratlösung (3.2% - 0.109M) - 10 bags gepufferte Natriumcitratlösung (3.2% - 0.109M)...
121,62 € *
gepufferte Natriumcitratlösung (3.2% - 0.109M) - 5 bags gepufferte Natriumcitratlösung (3.2% - 0.109M)...
158,02 € *
Natriumacetat-Puffer (pH5,2) - 5 bags Natriumacetat-Puffer (pH5,2) - 5 bags
272,79 € *
Natriumacetat-Puffer (pH7,0) - 5 bags Natriumacetat-Puffer (pH7,0) - 5 bags
272,79 € *
Natriumchlorid (3M) - 5 bags Natriumchlorid (3M) - 5 bags
111,36 € *
SDS (10%) - 5 bags SDS (10%) - 5 bags
443,18 € *
Natriumphosphatpuffer (pH6,5 - 1M) - 10 bags Natriumphosphatpuffer (pH6,5 - 1M) - 10 bags
217,15 € *
Natriumphosphatpuffer (pH7,2 - 1M) - 10 bags Natriumphosphatpuffer (pH7,2 - 1M) - 10 bags
217,15 € *
Natriumphosphatpuffer (pH7,0 - 0,02M - 10 bags) Natriumphosphatpuffer (pH7,0 - 0,02M - 10 bags)
ab 115,11 € *
Trispuffer (pH7,4) - 10 bags Trispuffer (pH7,4) - 10 bags
313,17 € *
Trispuffer - 1M, pH8,0 - 10 bags Trispuffer - 1M, pH8,0 - 10 bags
313,17 € *
Trispuffer (pH8,3) - 10 bags Trispuffer (pH8,3) - 10 bags
313,17 € *
10-fach Tris gepufferte Salzlösung (pH8,0) - 10 bags 10-fach Tris gepufferte Salzlösung (pH8,0) - 10...
478,62 € *
Tris gepufferte Salzlösung (pH8,0) - 10 bags Tris gepufferte Salzlösung (pH8,0) - 10 bags
121,08 € *
TBS buffer tablets - ready-to-use TBS Puffertabletten (pH7.6 - 500mL)
ab 96,50 € *
TBS mit Tween®20, pH7.6 (500mL) TBS mit Tween®20, pH7.6 (500mL)
ab 73,18 € *
50-fach Tris-Acetat-EDTA Puffer (pH8,3 - 5 bags) 50-fach Tris-Acetat-EDTA Puffer (pH8,3 - 5 bags)
ab 340,20 € *
10-fach Tris-Borat-EDTA Puffer (pH 8,3) - 10 bags 10-fach Tris-Borat-EDTA Puffer (pH 8,3) - 10 bags
346,90 € *
10-fach Tris-EDTA Puffer (pH 7,4) - 10 Beutel 10-fach Tris-EDTA Puffer (pH 7,4) - 10 Beutel
189,26 € *
Tris-Glycin Puffer (pH8,3 - 10 bags) Tris-Glycin Puffer (pH8,3 - 10 bags)
ab 111,43 € *
5M Urea - pre-weight Harnstoff 5M - 5 bags
148,43 € *
IMAC Phosphatpuffer IMAC Phosphatpuffer
ab 70,32 € *
IMAC Elutionspuffer IMAC Elutionspuffer
ab 76,22 € *
TAE buffer (10-fach) gebrauchsfertige Lösung TAE buffer (10-fach) gebrauchsfertige Lösung
ab 61,29 € *
ready-to-use 50-time TAE buffer TAE Puffer (50-fach) gebrauchsfertige Lösung
ab 48,72 € *
10-fach TBE Puffer gebrauchsfertig 10-fach TBE Puffer gebrauchsfertig
ab 42,32 € *
TBE buffer ready-to-use 10-fach TBE Puffer gebrauchsfertige Lösung...
ab 42,57 € *
1-fach TE Puffer / Tris-EDTA Pufferlösung - pH8,0 1-fach TE Puffer / Tris-EDTA Pufferlösung - pH8,0
ab 0,53 € *
1-fach TE Puffer / Tris-EDTA Pufferlösung - pH 7,5 1-fach TE Puffer / Tris-EDTA Pufferlösung - pH 7,5
ab 38,50 € *
Alpha MEM Eagle mit Nukleosiden, mit Glutamin, ohne Glucose - 500 mL Alpha MEM Eagle mit Nukleosiden, mit Glutamin,...
67,50 € *
Alpha MEM Eagle mit Nukleosiden, mit L-Glutamin, mit Glucose Alpha MEM Eagle mit Nukleosiden, mit...
55,57 € *
Alpha MEM Eagle ohne Glutamin, ohne Ribo- und Deoxyribonucleosiden Alpha MEM Eagle ohne Glutamin, ohne Ribo- und...
62,32 € *
Basal Medium (Eagle) mit EBSS ohne NaHCO3 Basal Medium (Eagle) mit EBSS ohne NaHCO3
55,57 € *
Basal Medium (Eagle) mit EBSS, ohne Glucose Basal Medium (Eagle) mit EBSS, ohne Glucose
16,29 € *
Basal Medium (Eagle) mit EBSS ohne Phenolrot Basal Medium (Eagle) mit EBSS ohne Phenolrot
58,26 € *
DMEM/F12, 1:1 Mix ohne alle Aminosäuren, mit Glucose DMEM/F12, 1:1 Mix ohne alle Aminosäuren, mit...
65,00 € *
DMEM/F12, 1:1 Mix mit stabilem Glutamin, mit HEPES DMEM/F12, 1:1 Mix mit stabilem Glutamin, mit HEPES
65,00 € *
DMEM/F12, 1:1 Mix ohne Phenolrot DMEM/F12, 1:1 Mix ohne Phenolrot
27,50 € *
DMEM/F12, 1:1 Mix mit L-Glutamin, ohne Glucose DMEM/F12, 1:1 Mix mit L-Glutamin, ohne Glucose
65,00 € *
DMEM/F12, 1:1 Mix ohne L-Glutamin, ohne Glucose DMEM/F12, 1:1 Mix ohne L-Glutamin, ohne Glucose
65,00 € *
DMEM ohne L-Glutamin, ohne Ca, mit 1g/L Glucose, mit Na-Pyruvat DMEM ohne L-Glutamin, ohne Ca, mit 1g/L...
65,00 € *
DMEM ohne Glutamin, ohne Aminosäuren, mit 1g/L Glukose DMEM ohne Glutamin, ohne Aminosäuren, mit 1g/L...
65,00 € *
DMEM mit 1g/L Glucose, ohne L-Glutamin, ohne L-Isoleucin DMEM mit 1g/L Glucose, ohne L-Glutamin, ohne...
65,00 € *
DMEM ohne Glutamin, ohne Cystin, ohne Methionin, ohne Glucose, ohne Natriumpyruvat DMEM ohne Glutamin, ohne Cystin, ohne...
65,00 € *
DMEM ohne Glutamin, ohne Arginin, ohne Lysin, ohne Glucose, ohne Natriumpyruvat DMEM ohne Glutamin, ohne Arginin, ohne Lysin,...
65,00 € *
DMEM für SILAC(TM) - ohne Glutamin, ohne Lysin, ohne Arginin, mit 4,5g/L Glucose DMEM für SILAC(TM) - ohne Glutamin, ohne Lysin,...
65,00 € *
DMEM ohne L-Cystein, ohne L-Methionin, ohne L-Glutamin, mit 4,5 g/L Glucose DMEM ohne L-Cystein, ohne L-Methionin, ohne...
65,00 € *
DMEM ohne Arginin, ohne Glutamin, mit Natriumpyruvat, mit 4,5 g/L Glucose DMEM ohne Arginin, ohne Glutamin, mit...
65,00 € *
DMEM ohne Glutamin, mit 4,5g/L Glucose, ohne nichtessentielle Aminosäuren DMEM ohne Glutamin, mit 4,5g/L Glucose, ohne...
65,00 € *
EMEM optimiert für Fibroblasten, ohne Glutamin EMEM optimiert für Fibroblasten, ohne Glutamin
66,00 € * ab 56,08 € *
Ham´s F-10 Medium, ohne L-Glutamin, ohne Phenolrot Ham´s F-10 Medium, ohne L-Glutamin, ohne Phenolrot
55,57 € *
Ham´s F-10 Medium mit stab. Glutamin, ohne Phenolrot Ham´s F-10 Medium mit stab. Glutamin, ohne...
55,57 € *
Ham´s F-12 Medium ohne Folsäure Ham´s F-12 Medium ohne Folsäure
55,57 € *
Ham´s F-12 Medium spezial mit L-Glutamin, ohne Phenolrot Ham´s F-12 Medium spezial mit L-Glutamin, ohne...
58,26 € *
Ham´s F-12 Medium ohne L-Glutamin, mit 2,5g/L NaHCO3 Ham´s F-12 Medium ohne L-Glutamin, mit 2,5g/L...
62,32 € *
Ham´s F-10 Medium ohne L-Glutamin Ham´s F-10 Medium ohne L-Glutamin
21,03 € *
Iscove´s Modified Dulbecco´s Medium ohne Glutamin, mit 20 mM Hepes - 500 mL Iscove´s Modified Dulbecco´s Medium ohne...
55,57 € *
Iscove´s Modified Dulbecco´s Medium, mit stab. Glutamin, mit 25 mM Hepes, ohne Phenolrot Iscove´s Modified Dulbecco´s Medium, mit stab....
58,26 € *
Leibovitz´s L-15 Medium mit Glutamin, mit 2,0g/L NaHCO3 Leibovitz´s L-15 Medium mit Glutamin, mit...
58,26 € *
Leibovitz´s L-15 Medium ohne Glutamin, ohne NaHCO3 Leibovitz´s L-15 Medium ohne Glutamin, ohne NaHCO3
62,32 € *
McCoy´s 5A Medium (Modified) ohne Glutamin, ohne Phenolrot McCoy´s 5A Medium (Modified) ohne Glutamin,...
55,57 € *
McCoy´s 5A Medium (Modified) mit Glutamin, ohne Phenolrot McCoy´s 5A Medium (Modified) mit Glutamin, ohne...
55,57 € *
Medium 199 mit Earle´s BSS ohne L-Glutamin Medium 199 mit Earle´s BSS ohne L-Glutamin
13,44 € *
Medium 199 mit Earle´s BSS ohne Glutamin, mit 0,35 g/L NaHCO3 Medium 199 mit Earle´s BSS ohne Glutamin, mit...
55,57 € *
Medium 199 with Earle´s BSS ohne Glutamin, ohne Phenolrot, mit 25 mM Hepes Medium 199 with Earle´s BSS ohne Glutamin, ohne...
68,42 € *
Medium 199 with Hank´s BSS mit 15 mM Hepes Medium 199 with Hank´s BSS mit 15 mM Hepes
58,26 € *
DMEM mit L-Glutamin, mit 4,5g/L Glucose, ohne Serin DMEM mit L-Glutamin, mit 4,5g/L Glucose, ohne...
65,00 € *
MEM Eagle with Earle´s BSS mit L-Glutamin, mit 20 mM Hepes MEM Eagle with Earle´s BSS mit L-Glutamin, mit...
55,57 € *
MEM Eagle with Earle´s BSS ohne L-Glutamin, ohne NaHCO3 MEM Eagle with Earle´s BSS ohne L-Glutamin,...
58,26 € *
MEM Eagle with Earle´s BSS ohne L-Glutamin, mit 20 mM Hepes, ohne NaHCO3 MEM Eagle with Earle´s BSS ohne L-Glutamin, mit...
58,26 € *
MEM Eagle with Earle´s BSS mit D-Valin, ohne Glutamin MEM Eagle with Earle´s BSS mit D-Valin, ohne...
58,26 € *
MEM Eagle with Hank´s BSS mit L-Glutamin, mit 0,60 g/L NaHCO3 MEM Eagle with Hank´s BSS mit L-Glutamin, mit...
58,26 € *
RPMI 1640 ohne L-Cystein und L-Methionin RPMI 1640 ohne L-Cystein und L-Methionin
65,00 € *
RPMI 1640 mit 20mM Hepes, mit stab. Glutamin, mit NEAAs RPMI 1640 mit 20mM Hepes, mit stab. Glutamin,...
65,00 € *
RPMI 1640 ohne Aminosäuren, ohne Folsäure RPMI 1640 ohne Aminosäuren, ohne Folsäure
65,00 € *
RPMI 1640 mit L-Glutamin, mit 110 mg/L Pyruvat RPMI 1640 mit L-Glutamin, mit 110 mg/L Pyruvat
65,00 € *
RPMI 1640 ohne Ca, ohne L-Glutamin RPMI 1640 ohne Ca, ohne L-Glutamin
65,00 € *
RPMI 1640 ohne L-Glutamin, ohne L-Isoleucin RPMI 1640 ohne L-Glutamin, ohne L-Isoleucin
65,00 € *
RPMI 1640 mit L-Glutamin, ohne L-Isoleucin RPMI 1640 mit L-Glutamin, ohne L-Isoleucin
65,00 € *
RPMI 1640 ohne Glucose, ohne L-Glutamin RPMI 1640 ohne Glucose, ohne L-Glutamin
65,00 € *
RPMI 1640 mit L-Glutamin, ohne Glucose RPMI 1640 mit L-Glutamin, ohne Glucose
65,00 € *
RPMI 1640 mit stab. Glutamin, ohne Phenolrot, ohne Glucose RPMI 1640 mit stab. Glutamin, ohne Phenolrot,...
20,60 € *
William´s Medium E mit stab. Glutamin, ohne Phenolrot - 500 mL William´s Medium E mit stab. Glutamin, ohne...
67,47 € *
William´s Medium E ohne Glutamin, ohne Glucose William´s Medium E ohne Glutamin, ohne Glucose
67,47 € *
William´s Medium E ohne Glutamin, ohne Glucose, ohne Phenolrot - 500 mL William´s Medium E ohne Glutamin, ohne Glucose,...
68,85 € *
William´s Medium E ohne Glutamin, ohne Glucose, ohne Natriumpyruvat - 500 mL William´s Medium E ohne Glutamin, ohne Glucose,...
67,47 € *
CMRL-1066 ohne L-Glutamin, ohne Phenolrot CMRL-1066 ohne L-Glutamin, ohne Phenolrot
34,26 € *
CMRL-1066 mit L-Glutamin CMRL-1066 mit L-Glutamin
62,32 € *
Grace´ Insect Medium ohne Glutamin - 500mL Grace´ Insect Medium ohne Glutamin - 500mL
58,26 € *
Grace´s Insect Medium mit Glutamin Grace´s Insect Medium mit Glutamin
57,15 € *
IPL-41 Insect Medium ohne L-Glutamin, ohne Sulfat IPL-41 Insect Medium ohne L-Glutamin, ohne Sulfat
72,18 € *
1 von 4
humanes FSH - GenLadder 100 L - -Fucose DMSO für die GENAzol - RNA Natriumphosphat Collagenase Typ Variante 5x qPCR Red MasterMix Penicillin-Stre pUC18 pUC19 ROX Passive GelRed in dNTP-Mix Genaxx1Step GenLadder 1kb SDS für die Steriles Agarose LE - SNP Pol Trypanblau C.I. Ova 257-264 Nuklease und Trypsin aus GHRP-6 HotScriptase Storage Box für dNTP-Set SafeGel red
Diese Website verwendet Cookies, um Ihnen die bestmögliche Funktionalität bieten zu können.
Einverstanden