rmLIF - rek. Leukemia Inhibitory Factor

rmLIF - rek. Leukemia Inhibitory Factor


Artikel-Nr.: C6516.0006

Shipping: shipped at RT, stored at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

145,00 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Leukemia Inhibitory Factor (LIF) ist ein lymphoider Faktor der die Langzeit Aufrechterhaltung... mehr
Produktinformationen "rmLIF - rek. Leukemia Inhibitory Factor"

Leukemia Inhibitory Factor (LIF) ist ein lymphoider Faktor der die Langzeit Aufrechterhaltung embryonaler Stammzellen unterstützt in dem die spontane Zelldifferenzierung unterdrückt wird. LIF hat vielerlei Funktionen, wie die cholinergene Neuronendifferenzierung, Kontrolle der Stammzellen-Pluripotenz, Knochen und Fettmetabolismus, Mitogenese von faktorabhängigen Zelllinien und Unterstützung der Megakaryozytenproduktion in vivo. Humanes und Maus-LIF zeigen 78% Identität in der Aminosäuresequenz. Humanes LIF wirkt auf humane Zellen genauso stark, wie auf Mauszellen. Maus-LIF hingegen zeigt eine um etwa 1000-fach verminderte Aktivität auf humane Zellen, im Vergleich zur Wirkung von humanem LIF.

Rec. Mausleukemia Inhibitory Factor aus E.Coli ist ein nichtglykosyliertes Polypeptid von 181 Aminosäuren und einer molaren Masse von 20kDa.

Leukemia Inhibitory Factor wird als steril filtriertes, weißes lyophilisiertes Pulver aus einer konzentrierten (1mg/mL) Lösung die 20mM Phosphatpuffer mit pH7,4 und 0,02% Tween-20.

Aminosäuresequenz: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.

Biologische Aktivität: Die Aktivität des rekombinanten Mäuse LIF wurde mittels der M1 Zelldifferenzierungsassay bestimmt und als <0.01ng/mL fest gestellt, was einer spezfischen Aktivität von 100.000.000 IU/mg entspricht. 50 Units sind definiert, als die Menge an LIF die in Zellkulturmedien 50% von M1 Kolonien zur Differenzierung anregt.

Synonyme: CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.

Patentrechtliche Gesichtspunkte: Der Verkauf und/oder die kommerzielle Verwendung von rec. Maus LIF ist in den Vereinigten Staaten von Amerika (U.S.A.) verboten.

Weitere Artikel passend zu "rmLIF - rek. Leukemia Inhibitory Factor"
Specifications: Purity: min. 95% (HPLC) Specific activity: 100MIU/mg mehr
 

Technische Daten:

Specifications:
Purity: min. 95% (HPLC)
Specific activity: 100MIU/mg

Quelle

Escherichia Coli.

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu rmLIF - rek. Leukemia Inhibitory Factor. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Literatur .... mehr

Referenzen..

Hier finden Sie Artikel und Literaturzitate, in denen die Autoren auf die hohe Qualität dieses Genaxxonprodukts vertrauen.
Listed below are articles and references, in which the authors trust in the high quality of this Genaxxon product.

Quelle/Source: NCBI PubMed >

Integrative Modeling Reveals Annexin A2-mediated Epigenetic Control of Mesenchymal Glioblastoma

Teresia Kling, Roberto Ferrarese, Darren Ó hAilín, Patrik Johansson, Dieter Henrik Heiland, Fangping Dai, Ioannis Vasilikos, Astrid Weyerbrock, Rebecka Jörnsten, Maria Stella Carro, Sven Nelander

EBioMedicine. 2016 Oct; 12: 72–85. Published online 2016 Sep 18. doi: 10.1016/j.ebiom.2016.08.050

PMCID: PMC5078587

 

c-Jun-N-terminal phosphorylation regulates DNMT1 expression and genome wide methylation in gliomas

Dieter H Heiland, Roberto Ferrarese, Rainer Claus, Fangping Dai, Anie P Masilamani, Eva Kling, Astrid Weyerbrock, Teresia Kling, Sven Nelander, Maria S Carro

Oncotarget. 2017 Jan 24; 8(4): 6940–6954. Published online 2016 Dec 28. doi: 10.18632/oncotarget.14330

PMCID: PMC5351681