Kontrollpeptid Amyloid-beta (40-1) human

Kontrollpeptid Amyloid-beta (40-1) human

Artikel-Nr.: P2252.0001

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

234,04 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

Kontrollpeptid Amyloid-beta (40-1). Charakteristisch für die Alzheimer-Krankheit ist die... mehr
Produktinformationen "Kontrollpeptid Amyloid-beta (40-1) human"

Kontrollpeptid Amyloid-beta (40-1). Charakteristisch für die Alzheimer-Krankheit ist die Anreicherung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäuren, die durch Selbstorganisation unlösliche Fibrillen bilden. Die Amyloid-ß-Peptide sind Fragmente des auf Chromosom 21 codierten, breit verteilten membrangebundenen Amyloid-Vorläuferproteins APP. Sie entstehen aus der proteolytischen Spaltung von APP durch beta- und gamma-Sekretasen. Die Spaltung erfolgt nach Aminosäurerest 40 oder nach Aminosäurerest 42. Selbst geringfügig erhöhte Mengen an Amyloid-ß 1-42 werden als ausreichend für die Alzheimer-Krankheit beschrieben.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

Weitere Artikel passend zu "Kontrollpeptid Amyloid-beta (40-1) human"
Specifications: Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Purity: >95% (HPLC)... mehr

Technische Daten:

Purity: >95% (HPLC)
Appearance: lyophilized, white powder



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu Kontrollpeptid Amyloid-beta (40-1) human. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.