Biotinyliertes Amyloid-beta (1-40) human

Biotinyliertes Amyloid-beta (1-40) human

Artikel-Nr.: P2254.0001

Shipping: shipped at RT, store at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

480,82 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für... mehr
Produktinformationen "Biotinyliertes Amyloid-beta (1-40) human"

Biotinyliertes Amyloid-ß (1-40) Peptid. Biotinylierte Peptide sind ein nützliches Werkzeug für viele wichtige Anwendungen in der Alzheimerforschung. Biotin hat eine starke Affinität zu Avidin oder Streptavidin. Diese Wechselwirkung kann zum qualitativen und quantitativen Nachweis, zur Markierung oder zur Immobilisierung verwendet werden. Die biotinylierten Amyloid-ß-Peptide sind N-terminal markiert. Zwei 6-Aminohexansäurereste werden als Spacer zwischen das Amyloid-ß-Peptid selbst und Biotin eingefügt. Der vergrößerte Abstand minimiert die sterische Hinderung und verbessert die Verfügbarkeit von Biotin für die Avidin- oder Streptavidinbindung.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

Weitere Artikel passend zu "Biotinyliertes Amyloid-beta (1-40) human"
Specifications: Sequence: Biotin-Aca-Aca-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Purity:... mehr

Technische Daten:

Purity: >95% (HPLC)



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu Biotinyliertes Amyloid-beta (1-40) human. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: oder Tel.: +49 731 3608 123.