[beta]-Amyloid (10-20) - YEVHHQKLVFF

[beta]-Amyloid (10-20) - YEVHHQKLVFF

Artikel-Nr.: P2304.9505

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

200,85 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the... mehr
Produktinformationen "[beta]-Amyloid (10-20) - YEVHHQKLVFF"

[beta]-Amyloid (10-20) (peptide sequence: YEVHHQKLVFF) ist used as a test peptide for the hydrophilic part of the complete Amyloid beta 1-42 peptide.

Amyloid-beta (1-42) human is an Alzheimer desease peptide. Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly. The amyloid-ß-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by ß- and g-secretases. Cleavage occurs after residue 40 or after residue 42. Even slightly increased amounts of Amyloid-beta 1-42 are described to be sufficient to cause Alzheimer's disease.

Related products:
P2255 - Amyloid-beta (16-20) - KLVFF
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide

Weitere Artikel passend zu "[beta]-Amyloid (10-20) - YEVHHQKLVFF"
Sequence:  YEVHHQKLVFF Purity:  >95% (HPLC) mehr

Technische Daten:

Purity: >95% (HPLC)


Fibrilization, fibrillogenesis studies



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu [beta]-Amyloid (10-20) - YEVHHQKLVFF. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "[beta]-Amyloid (10-20) - YEVHHQKLVFF"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.