[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS

[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS

Artikel-Nr.: P2429.9505

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

90,00 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

Aminosäuresequenz RERMS stellt die aktive Domäne des Amyloid-Beta / A4-Proteinvorläufers dar,... mehr
Produktinformationen "[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS"

Aminosäuresequenz RERMS stellt die aktive Domäne des Amyloid-Beta / A4-Proteinvorläufers dar, die das Fibroblastenwachstum fördert; H. Ninomiya et al .; J. Cell. Biol. 121, 879 (1993).

Das Merkmal der Alzheimer-Krankheit ist die Ansammlung von Amyloid-Plaques im Gehirn. Die Hauptkomponenten dieser Plaques sind Amyloid-ß-Peptide mit 39-42 Aminosäureresten, die durch Selbstorganisation unlösliche Fibrillen bilden. Die Amyloid-ß-Peptide sind Fragmente des auf Chromosom 21 codierten, breit verteilten membrangebundenen Amyloid-Vorläuferproteins APP. Sie entstehen aus der proteolytischen Spaltung von APP durch beta- und gamma-Sekretasen. Die Spaltung erfolgt nach Aminosäurerest 40 oder 42. Selbst geringfügig erhöhte Mengen an Amyloid-ß 1-42 werden als ausreichend für die Alzheimer-Krankheit beschrieben.

P2255 - Amyloid-beta (16-20) - KLVFF >
P2304 - Amyloid-beta (10-20) - YEVHHQKLVFF >
P2250 - Amyloid-beta (1-40) human - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >
P2248 - Amyloid-beta (1-40) rat - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - HCl salt peptide >

Weitere Artikel passend zu "[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS"
Specifications: Purity: >95% (HPLC) Sequence: RERMS Appearance: lyophilized, white... mehr

Technische Daten:

Purity: >95% (HPLC)
Sequence: RERMS
Appearance: lyophilized, white powder


study of Alzheimer desease Fibrilization, fibrillogenesis studies



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu [beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "[beta]-Amyloid/A4 Protein Precursor (APP) (328 - 332) - RERMS"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.