humanes LL-37 [LL-37, 37 aa]

Artikel-Nr.: P2299.9501
Shipping: shipped at RT, store at -20°C Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.
Menge | Stückpreis |
---|---|
bis 2 | 306,43 € * |
ab 3 | 245,14 € * |
Preise zzgl. gesetzlicher MwSt. zzgl. Versandkosten
Infos Lieferbedingungen & Versandkosten >>
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.
Amino acid sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)
Technische Daten:
Specifications:
Purity: >70% (HPLC)
Sequence: [LL-37, 37 aa]
Sequence (three letter code): Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
C205H341N61O52
MW = 4493.3 g/mol
Lyophilized white powder
Applikation:
LL-37 is used to study host defense mechanisms.Quelle
syntheticSicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 34-16-04-90Dokumente - Protokolle - Downloads
Hier finden Sie Informationen und weiterführende Literatur zu humanes LL-37 [LL-37, 37 aa] Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.