Artikel-Nr.: P2955.9505

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

Menge Stückpreis
bis 2 300,00 € *
ab 3 285,00 € *


Wählen Sie bitte die gewünschte Packungsgröße aus.


Wählen Sie bitte die gewünschte Reinheit aus.

LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with... mehr

LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.

Amino acid sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)

Specifications: Purity: >95% (HPLC) Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR... mehr

Technische Daten:

Purity: >95% (HPLC)
MW = 4493.3 g/mol
Lyophilized white powder


LL-37 is used to study host defense mechanisms.



Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu humanes LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: oder Tel.: +49 731 3608 123.