Antide Acetate

Antide Acetate


Artikel-Nr.: C6453.0005

Shipping: shipped at RT, stored at -20°C
CAS-Nr: 112568-12-4

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

270,38 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s... mehr
Produktinformationen "Antide Acetate"

Antide acetate is a peptide which acts as an LHRH antagonist and can be utilized by an animal’s body to represses FSH and LH releases that stem from the pituitary gland. Synthetic versions of this chemical have been developed for use/controlling of these reactions in a laboratory setting, both as a means to determine a potential medical use for antide acetate and to help researchers better understand the role of this chemical in an animal’s body when it is naturally produced.

Antide acetate that is prepared for laboratory use is provided as a lyophilized sterile powder that can be reconstituted with an aqueous solution as necessary for the given application. Researchers are encouraged to seek out a supply that is prepared without additives, to ensure accurate and reliable testing results once the chemical is in use.

Synonym: Ac-D-2-Nal-4-chloro-D-Phe-β-(3-pyridyl)-D-Ala-Ser-Lys(nicotinoyl)-D-Lys(nicotinoyl)-Leu-Lys(isopropyl)-Pro-D-Ala-NH₂ acetate salt.

Weitere Artikel passend zu "Antide Acetate"
Specifications: Purity: >94% (HPLC) Appearance: sterile filtered white lyophilized... mehr
 

Technische Daten:

Specifications:
Purity: >94% (HPLC)
Appearance: sterile filtered white lyophilized (freeze-dried) powder without any addititves
Chemical f
ormula: C82H108ClN17O14
MW = 1591.32 g/mol

Applikation:

Inhibiting Liomyoma Extracellular Matrix Production Cancer Research

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

CAS-Nr: 112568-12-4
eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu Antide Acetate. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Antide Acetate"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
ab 112,50 € * 125,00 € *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
ab 85,50 € * 90,00 € *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
ab 441,75 € * 465,00 € *