rhCG - Corticotropin releasing hormone binding protein

rhCG - Corticotropin releasing hormone binding protein


Artikel-Nr.: C6461.0010

Shipping: shipped at RT, stored at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

259,92 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides.... mehr
Produktinformationen "rhCG - Corticotropin releasing hormone binding protein"

CRH is a powerful stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. CRH concentration in the human peripheral circulation is usually low. The concentration rises during pregnancy and fall back quickly after parturition. Maternal plasma CRH most likely originates from the placenta. Human plasma has a CRH-binding protein that inactivates CRH and can inhibit inappropriate pituitary-adrenal stimulation in pregnancy.

Human recombinant CRHBP is a 34.58 kDa protein containing 308 aa and fused to a 10 aa N-Terminal His-tag.

Synonyms: Corticotropin releasing hormone binding protein, CRF-BP, CRH-BP, CRF-binding protein.

Amino acid sequence: MKHHHHHHAS YLELREAADY DPFLLFSANL KRELAGEQPY RRALRCLDML SLQGQFTFTA DRPQLHCAAF FISEPEEFIT IHYDQVSIDC QGGDFLKVFD GWILKGEKFP SSQDHPLPSA ERYIDFCESG LSRRSIRSSQ NVAMIFFRVH EPGNGFTLTI KTDPNLFPCN VISQTPNGKF TLVVPHQHRN CSFSIIYPVV IKISDLTLGH VNGLQLKKSS AGCEGIGDFV ELLGGTGLDP SKMTPLADLC YPFHGPAQMK VGCDNTVVRM VSSGKHVNRV TFEYRQLEPY ELENPNGNSI GEFCLSGL YLELREAADY DPFLLFSANL KRELAGEQPY RRALRCLDML SLQGQFTFTA DRPQLHCAAF FISEPEEFIT IHYDQVSIDC QGGDFLKVFD GWILKGEKFP SSQDHPLPSA ERYIDFCESG LSRRSIRSSQ NVAMIFFRVH EPGNGFTLTI KTDPNLFPCN VISQTPNGKF TLVVPHQHRN CSFSIIYPVV IKISDLTLGH VNGLQLKKSS AGCEGIGDFV ELLGGTGLDP SKMTPLADLC YPFHGPAQMK VGCDNTVVRM VSSGKHVNRV TFEYRQLEPY ELENPNGNSI GEFCLSGL

Weitere Artikel passend zu "rhCG - Corticotropin releasing hormone binding protein"
Specifications: Appearance: Filtered white lyophilized powder. CRHBP Human was filtered... mehr
 

Technische Daten:

Specifications:
Appearance: Filtered white lyophilized powder. CRHBP Human was filtered (0.4µm) and lyophilized from a 0.5mg/mL solution with 20mM TRIS and 20mM NaCl, pH7.5.

 

Applikation:

ELISA Western blotting

Quelle

E.Coli

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu rhCG - Corticotropin releasing hormone binding protein. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "rhCG - Corticotropin releasing hormone binding protein"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
ab 115,88 € * 125,00 € *
ACTH (1-10). human SYSMEHFRWG ACTH (1-10). human SYSMEHFRWG
ab 85,50 € * 90,00 € *
ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39). human...
ab 441,75 € * 465,00 € *