humanes FSH - Follikel stimulierendes Hormon

humanes FSH - Follikel stimulierendes Hormon


Artikel-Nr.: C6468.0500

Shipping: shipped at RT, stored at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

245,00 € *

Units:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Humanes FSH (Follikel stimulierendes Hormon) ist ein Hormon, das von den Gonadotropen in der... mehr
Produktinformationen "humanes FSH - Follikel stimulierendes Hormon"

Humanes FSH (Follikel stimulierendes Hormon) ist ein Hormon, das von den Gonadotropen in der vorderen Hypophyse synthetisiert und ausgeschieden wird. FSH und LH wirken bei Frauen in der fortpflanzungsfähigen Phase synergistisch zusammen. FSH regt im Eierstock das Wachstum von unreifen Graafschen Follikeln zur Reifung an. Während das Follikel wächst, setzt es Inhibin frei, das dann die FSH Produktion abschaltet.

Bei Männern erhöht FSH die Produktion von Androgen bindendem Protein durch die Sertoli-Zellen der Hoden und ist entscheidend für die Spermatogenese.

Sowohl bei Männern als auch bei Frauen stimuliert FSH die Reifung von Keimzellen. Bei Frauen initiiert FSH das Follikelwachstum, das speziell Granulosazellen betrifft. Mit dem Anstieg der Inhibin B Konzentration, sinkt der FSH-Spiegel während der spätfollikulären Phase. Dies scheint entscheidend für die Auswahl des am weitesten fortgeschrittenen Follikels zu sein, um zum Eisprung überzugehen. Am Ende der Lutealphase tritt ein leichter Anstieg des FSH-Spiegels auf, der für den Beginn des nächsten Ovulationszyklus von Bedeutung zu sein scheint.

Wie bei seinem Partner LH wird auch die FSH-Freisetzung in der Hypophyse durch Impulse des Gonadotropin-Releasing-Hormons (GnRH) gesteuert. Diese Impulse unterliegen wiederum der Östrogen-Rückkopplung von den Gonaden.

Weitere Artikel passend zu "humanes FSH - Follikel stimulierendes Hormon"
Unser Kommentar zu "humanes FSH - Follikel stimulierendes Hormon"
Less than: 0.1% hCG, 0.5% TSH, 0.5% LH, 0.5% GH and 0.5% Prl. Free of HbsAg, antibodies to HIV and HCV.
Specifications: MW: about 30kDa heterodimeric protein of 92 and 111 amino acids Less than:... mehr
 

Technische Daten:

Specifications:
MW: about 30kDa
heterodimeric protein of 92 and 111 amino acids
Less than: 0.1% hCG, 0.5% TSH, 0.5% LH, 0.5% GH and 0.5% Prl.

free of HbsAG, antibodies to HIV and HCV

Quelle

urine of post-menopausal women.

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu humanes FSH - Follikel stimulierendes Hormon. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "humanes FSH - Follikel stimulierendes Hormon"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
ab 115,88 € * 125,00 € *
ACTH (1-10). human SYSMEHFRWG ACTH (1-10). human SYSMEHFRWG
ab 85,50 € * 90,00 € *
ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39). human...
ab 441,75 € * 465,00 € *