Growth-hormone-releasing hormone (GHRH)

Growth-hormone-releasing hormone (GHRH)


Artikel-Nr.: C6470.1000

Shipping: shipped at RT, stored at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

252,35 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or... mehr
Produktinformationen "Growth-hormone-releasing hormone (GHRH)"

Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acid peptide hormone produced in the arcuate nucleus of the hypothalamus. GHRH is released from neurosecretory nerve terminals of these arcuate neurons, and is carried by the hypothalamo-hypophysial portal circulation to the anterior pituitary gland where it stimulates growth hormone (GH) secretion. GHRH also stimulates the production of GH. GHRH is released in a pulsatile manner, stimulating similar pulsatile release of GH. In addition, GHRH also promotes slow-wave sleep directly.

This synthetic Growth Hormone Releasing Hormone is a single, non-glycosylated, polypeptide of 29 amino acids and a molecular mass of 3358.9 Dalton. It corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone of 44 amino acids. This GHRH peptide (1mg/mL) was lyophilized after extensive dialyses against 1.7mg sodium phosphate buffer (0.1mg sodium phosphate monobasic and 1.6mg sodium phosphate dibasic).

Amino acid sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2.

Biological activity: GHRH increases plasma growth hormone concentrations by directly stimulating the anterior pituitary gland to release natural human growth hormone.

Synonyms: Somatoliberin, Growth hormone-releasing factor, GRF, Growth hormone-releasing hormone, GHRH, Somatocrinin, Somatorelin, Sermorelin, GHRF, MGC119781.

Weitere Artikel passend zu "Growth-hormone-releasing hormone (GHRH)"
Purity: >98.0% (RP-HPLC, SDS-PAGE); C149H246N44O42S. Sequence:... mehr
 

Technische Daten:

Purity: >98.0% (RP-HPLC, SDS-PAGE); C149H246N44O42S.

Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2. MW = 3358.9 g/mol. non-glycoslyated.

 

Quelle

chemical synthesis

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu Growth-hormone-releasing hormone (GHRH). Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Growth-hormone-releasing hormone (GHRH)"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
ab 112,50 € * 125,00 € *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
ab 85,50 € * 90,00 € *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
ab 441,75 € * 465,00 € *