hGHRP-2 / Human Growth Hormone Releasing Peptide-2

hGHRP-2 / Human Growth Hormone Releasing Peptide-2


Artikel-Nr.: C6471.0025

Shipping: shipped at RT, stored at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

231,75 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides... mehr
Produktinformationen "hGHRP-2 / Human Growth Hormone Releasing Peptide-2"

Human Growth Hormone Releasing Peptide-2. GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs to stimulate GH release. GHRP-2, an investigational drug, is one of the most potent members of the GHRP family. It has been shown to be effective in adults via the oral and intranasal as well as the iv route of administration.

Growth Hormone Releasing Peptide-2 Synthetic is a synthetic peptide including unnatural D-form amino acids (D-Ala-D-2-NAL-Ala-Trp-D-Phe-Lys).

Synonyms: GHRP-2, GHRP.

Weitere Artikel passend zu "hGHRP-2 / Human Growth Hormone Releasing Peptide-2"
Purity: >98.0% (RP-HPLC). Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2; MW = 817.9 g/mol. mehr
 

Technische Daten:

Purity: >98.0% (RP-HPLC). Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2; MW = 817.9 g/mol.

Quelle

chemical synthesis

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu hGHRP-2 / Human Growth Hormone Releasing Peptide-2. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "hGHRP-2 / Human Growth Hormone Releasing Peptide-2"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
ab 112,50 € * 125,00 € *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
ab 85,50 € * 90,00 € *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
ab 441,75 € * 465,00 € *