hPTH - humanes Parathyroidhormon (aa 1-34)

hPTH - humanes Parathyroidhormon (aa 1-34)


Artikel-Nr.: C6500.1000

Shipping: shipped at RT, stored at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

231,75 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a... mehr
Produktinformationen "hPTH - humanes Parathyroidhormon (aa 1-34)"

Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide of 84 amino acids. It acts to increase the concentration of calciumin in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration. PTH acts to increase the concentration of calcium in the blood by acting upon parathyroid hormone receptor in three parts of the body: In the bones it enhances the release of calcium from the large reservoir contained in the bones. Bone resorption is the normal destruction of bone by osteoclasts, which are indirectly stimulated by PTH. Stimulation is indirect since osteoclasts do not have a receptor for PTH; rather, PTH binds to osteoblasts, the cells responsible for creating bone. Binding stimulates osteoblasts to increase their expression of RANKL, which can bind to osteoclast precursors containing RANK, a receptor for RANKL. The binding of RANKL to RANK stimulates these precursors to fuse, forming new osteoclasts which ultimately enhances the resorption of bone.
In the kidney it enhances active reabsorption of calcium from distal tubules and the thick ascending limb.
In the intestine it enhances the absorption of calcium by increasing the production of vitamin D and upregulating the enzyme responsible for 1-alpha hydroxylationof 25-hydroxy vitamin D, converting vitamin D to its active form (1,25-dihydroxy vitamin D) which effects the actual absorption of calcium (as Ca2+ ions) by the intestine via calbindin.

Recombinant human full length PTH 1-84 has potential as an anti-osteoporotic agent, due to its properties as a bone formation stimulant, it increases bone turnover, stimulating osteoblasts and reducing both vertebral and non vertebral fractures.

Synthetisches humanes Parathyroidhormon (C181H290N55O51S2) besteht aus einem Polypeptid von 34 Aminosäuren und einer Molmasse von 4117.8 Dalton.

Synonyme: Parathyrin, PTH, Parathormon.

Weitere Artikel passend zu "hPTH - humanes Parathyroidhormon (aa 1-34)"
Purity: min. 99.0% (HPLC). Amino acid sequence:... mehr
 

Technische Daten:

Purity: min. 99.0% (HPLC). Amino acid sequence: Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe. Delivered as lyophilized powder (lyophilized from a 1mg/mL solution). Chemical formula: C181H290N55O51S2.

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu hPTH - humanes Parathyroidhormon (aa 1-34). Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "hPTH - humanes Parathyroidhormon (aa 1-34)"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
ab 112,50 € * 125,00 € *
ACTH (1-10), human SYSMEHFRWG ACTH (1-10), human SYSMEHFRWG
ab 85,50 € * 90,00 € *
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ACTH (1-39), human...
ab 441,75 € * 465,00 € *