ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF


Artikel-Nr.: P2612.9505

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

Menge Stückpreis
bis 2 465,00 € *
ab 3 441,75 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Reinheit:

Wählen Sie bitte die gewünschte Reinheit aus.

ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid... mehr
Produktinformationen "ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF"

ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF ist ein synthetisches Peptid entsprechend den ersten 39 Aminosäuren des humanen ACTH/Adrenocorticotropin. Wie der Name schon sagt, stimuliert Adrenocorticotropin die Nebennierenrinde. Insbesondere stimuliert es die Sekretion von Glucocorticoiden wie Cortisol und zeigt auch etwas Kontrolle über die Sekretion von Aldosteron, dem anderen Hauptsteroidhormon aus der Nebennierenrinde. ACTH regt die Sekretion von Nebennierenrindenkortikosteroiden an und induziert das Wachstum der Nebennierenrinde. ACTH, auch Tetracosactide genannt, aktiviert G-Proteine direkt. Zusätzliche ist es ein Stimulanz für die Bildung von Adenylatcyclase und cAMP.

Weitere Artikel passend zu "ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF"
Specifications: Purity: >95% (HPLC, 214nm) Sequence:... mehr
 

Technische Daten:

Specifications:
Purity: >95% (HPLC, 214nm)
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence (three letter code): Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
chemical formula: C207H308N56O58S
Molecular Weight: 4541.13 g/mol
Appearance: lyophilized white powder

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "ACTH (1-39). human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

human growth hormon releasing factor 6 GHRP-6 HwAWfK-NH2
ab 112,50 € * 125,00 € *
ACTH (1-10). human SYSMEHFRWG ACTH (1-10). human SYSMEHFRWG
ab 85,50 € * 90,00 € *
ACTH (18-39). human RPVKVYPNGAEDESAEAFPLEF ACTH (18-39). human RPVKVYPNGAEDESAEAFPLEF
ab 261,25 € * 275,00 € *