MAGE-A3 Peptid-Pool

MAGE-A3 Peptid-Pool


Artikel-Nr.: P2965.70PP

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit 1-2 Werktage

210,00 € *

Reinheit:

Wählen Sie bitte die gewünschte Reinheit aus.

MAGE-A3 Control Pool bestehend aus 76 Peptiden basierend auf einem Peptid-Scan (15-mere mit 11... mehr
Produktinformationen "MAGE-A3 Peptid-Pool"

MAGE-A3 Control Pool bestehend aus 76 Peptiden basierend auf einem Peptid-Scan (15-mere mit 11 AA Überlappung) des Melanoma-associated Antigen 3 (MAGE-A3) (UniProt ID: P43357) von Homo sapiens (Human) für T-Zell Assays.

Löslichkeit: Die gelieferte, lyophilisierte Peptidmischung sollte in einem Minimum von 40µL reinem DMSO aufgenommen werden (stock solution). Diese Lösung wird dann mit PBS-Puffer zur gewünschten Arbeitskonzentration verdünnt. Bitte beachten Sie: Die DMSO-Konzentration in der Arbeitslösung muss unterhalb von 1% liegen, um toxische Nebenwirkungen in biologischen Systemen zu verhindern.

Gesamtlänge des Melanoma-associated Antigen 3: 314 Aminosäuren
Sequenz:
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEE
GPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLG
DNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHH
MVKISGGPHISYPPLHEWVLREGEE

Weitere Artikel passend zu "MAGE-A3 Peptid-Pool"
Specifications: Purity: >70% (HPLC) Amount: approx. 25µg of each peptide Origin/Protein:... mehr
 

Technische Daten:

Specifications:
Purity: >70% (HPLC)
Amount: approx. 25µg of each peptide
Origin/Protein: Melanoma-associated antigen 3
Organism: Homo sapiens (Human)
UniProtKB - P43357
lyophilized white powder

Applikation:

Usage: T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Indication(s)/Topic(s): Cancer, Melanoma

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu MAGE-A3 Peptid-Pool. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "MAGE-A3 Peptid-Pool"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.