SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilisiertes Trimer



Artikel-Nr.: S5333.0100

Shipping: shipped on dry ice, stored at -80°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

528,00 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Rekombinantes Spike-Protein SARS-CoV-2 (2019-nCoV) S1 Protein, stabilisiertes Trimer enthält... mehr
Produktinformationen "SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilisiertes Trimer"

Rekombinantes Spike-Protein SARS-CoV-2 (2019-nCoV) S1 Protein, stabilisiertes Trimer enthält spezifische Aminosäuresubstitutionen zur Stabilisierung der Präfusionskonformation (als 2P bezeichnet). Mit C-terminalem Strep- und His-Tag. Die Furin-Spaltstelle zwischen den S1/S2-Untereinheiten wurde deletiert und eine künstliche Trimerisierungsdomäne am C-terminalen Ende des Monomers hinzugefügt.

Das SARS-CoV-2-Spike Protein besteht aus einer trimeren Struktur. Die Struktur besteht aus drei identischen Transmembranproteinen, den sogenannten Spike-Proteinen, die jeweils zwei Untereinheiten enthalten: die S1- und die S2-Untereinheit. Die S1-Untereinheit ist für die Erkennung des Rezeptors auf der Oberfläche einer empfänglichen Zelle notwendig. Die S2-Untereinheit ist dagegen für die Fusion des Virus mit der Zellmembran der Wirtszelle verantwortlich. Nach Bindung des Wirtsrezeptors hACE2 wird die distale S1-Domäne gespalten. Die Abspaltung der distalen S1 Untereinheit legt die S2-Untereinheit frei, was wiederum den Eintritt in die Zelle ermöglicht. Außerdem ist das Spike-Protein stark glykosyliert. Diese Glykosylierung mit N-gebundene Glykane, ermöglicht erst die korrekte Faltung des Proteins und die Erkennung durch neutralisierende Antikörper.

 

Proteinsequenz:
Sequenz ohne tags (AS 16-1211):

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCN
DPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGW
TAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCY
GVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPT
NGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVP
VAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGASVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDST
ECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIA
QYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQID
RLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQII
TTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY
EQYIK

RefSeq Links: NC_045512.2; MN908947.3; YP_009724390.1; QHD43416.1; GeneID: 43740568; UniProt: P0DTC2

SARS-CoV-2-Spike (S)-Protein kann für die Entwicklung diagnostischer Kits eingesetzt werden. Es ist nicht für direkte Detektion von SARS-CoV-2 geeignet. Das Gegenstück zu SARS-CoV-2 ist das ACE2 (Angiotensin-konvertierendes Enzym-2), das bereits früher als Rezeptor für SARS-CoV beschrieben wurde.

Weitere Artikel passend zu "SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilisiertes Trimer"
Specifications: Formulation: PBS, 5% (w/v) Trehalose, pH7.4 Format: Liquid, stored and shipped... mehr
 

Technische Daten:

Specifications:
Formulation: PBS, 5% (w/v) Trehalose, pH7.4
Format: Liquid, stored and shipped at -80°C
Purity: >85% as determined by SDS-PAGE
with C-terminal His-Tag and Strep-Tag
MW: about 260 kDa

Expression host: human, HEK293
Species: Wuhan seafood market pneumonia virus; 2019-nCoV

Quelle

human, HEK293

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilisiertes Trimer. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.