Filter schließen
  •  
  •  
von bis
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
Für die Filterung wurden keine Ergebnisse gefunden!
Prod.Nr. Description     Price €
C6018.0020 rec. Human Interferon-Gamma (rHulFN-g) 
Recombinant Human IFN-g wird in E.Coli als nicht-glykosyliertes Polypeptid aus 144 Aminosäuren und einer molaren Masse von 16.879 Dalton hergestellt....
Peptides and Proteins 145,00
S5340.0100 SARS-CoV-2 Spike S1 Protein (RBD) mit His-Tag 
SARS-CoV-2 Spike Protein RBD Recombinant mit C-terminalem His-Tag ist ein rekombinantes Protein, das in flüssiger Form, gepuffert in PBS, vorliegt. Dieses...
Peptides and Proteins 345,00
C6003.0050 Coronavirus 2019 Nucleocapsid Mosaic Protein 
The E.Coli derived recombinant protein contains the Coronavirus 2019 full length nuclepocapsid Mosaic immunodominant regions [ full length N-antigen ], fused...
Peptides and Proteins 225,00
S5341.0050 SARS-CoV-2 Coronavirus 2019 Spike Glycoprotein-S1 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-674 fused to Fc tag...
Peptides and Proteins 995,00
S5342.0050 SARS-CoV-2 Novel Coronavirus 2019-nCoV Spike Glycoprotein-S2 
The HEK293 derived recombinant protein contains the Novel Coronavirus 2019-nCoV Spike Glycoprotein S2, Wuhan-Hu-1 strain, amino acids 685-1211 fused to Fc...
Peptides and Proteins 995,00
S5343.0050 SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic - with His-Tag 
SARS-CoV-2 Coronavirus 2019 Spike E-Mosaic is a recombinant protein expressed in E.Coli. The protein contains the SARS-CoV-2 spike (S), membrane (M), and...
Peptides and Proteins 225,00
S5346.0050 SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) 
SARS-CoV-2 Coronavirus 2019 Spike (800 -1000) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (800-1000 a.a.)...
Peptides and Proteins 225,00
S5345.0050 SARS-CoV-2 Coronavirus 2019 Spike (300-600) RBD 
SARS-CoV-2 Coronavirus 2019 Spike (300 -600) Receptor Binding Domain is derived as a recombinant protein from E.Coli. The protein contains the Coronavirus...
Peptides and Proteins 225,00
S5347.0050 SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) 
SARS-CoV-2 Coronavirus 2019 Spike (1000 -1200) is a recombinant protein derived from E.Coli. The protein contains the Coronavirus 2019 Spike (1000-1200 a.a.)...
Peptides and Proteins 225,00
P2299.9501 humanes LL-37 [LL-37, 37 aa] 
LL-37 [LL-37, 37 aa] is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is...
Peptides and Proteins 174,25
S5348.0100 SARS-CoV-2 (COVID-19) Nucleocapsidprotein - (1-419), His-Tag 
Das neue Coronavirus SARS-CoV-2 besteht unter seiner Hüllmembran aus einem ikosaedrischen Nukleokapsid, das seine genetische Information in Form von...
Peptides and Proteins 475,00
S5334.0100 SARS-CoV-2 Spike S1 Protein (RBD) - ohne Tag 
SARS-CoV-2 Spike Protein RBD Recombinant ohne His-Tag ist ein rekombinantes Protein, das in flüssiger Form, gepuffert in PBS, vorliegt. Dieses Protein wurde...
Peptides and Proteins 255,00
S5333.0100 SARS-CoV-2 (2019-nCoV) Spike S1 Protein, His-Tag, stabilisiertes Trimer 
Das SARS-CoV Spike (S) Glykoprotein ist für die Bindung des Virus an die Wirtszelle und die Membranfusion zu Beginn des Infektionsprozesses essentiell und...
Peptides and Proteins 528,00
S5344.0100 rekombinantes humanes ACE2 Protein (ECD), Avi/His-Tag, nicht biotinyliert 
Rekombinantes humanes ACE2-Protein (ECD. prozessiert) enthält einen Avi/His-Tag und ist bereit für die In-vitro-Biotinylierung, Wir bieten hohe Reinheit. und...
Peptides and Proteins 649,00
S5349.0100 hACE2 Protein (ECD, processed), Tag-free, liquid formulation 
Rekombinantes humanes ACE2-Protein (ECD. prozessiert), Wir bieten hohe Reinheit. und Qualität in HEK293 exprimiertes rekombinantes Protein für F&E made in...
Peptides and Proteins 649,00
S5361.0100 human ACE2 Protein (ECD), Avi/His-Tag, biotinylated 
Rekombinantes humanes ACE2-Protein (ECD. prozessiert) enthält einen Avi/His-Tag und ist biotyniliert, Wir bieten hohe Reinheit. und Qualität in HEK293...
Peptides and Proteins 979,00
1