SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides

SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides


Artikel-Nr.: P4014.0316

Shipping: shipped at RT, stored at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

Jubiläums-Angebot 20 Jahre GENAXXON

Statt: 592,25 € * (20 % gespart)
473,80 € *

Packungsgröße:

Wählen Sie bitte die gewünschte Packungsgröße aus.

SARS-CoV-2 (Spike Glycoprotein) Peptide Pool of 316 overlapping peptides (delivered in two... mehr
Produktinformationen "SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides"

SARS-CoV-2 (Spike Glycoprotein) Peptide Pool of 316 overlapping peptides (delivered in two subpools of 158 & 158 peptides) derived from a peptide scan (15mers with 11 aa overlap) through Spike glycoprotein (UniProt: P0DTC2) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).

Complete protein sequence of Spike (or Surface) Glycoprotein, Gene name: S (each peptide with about 25µg)

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNAT
NVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSY
LTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSA
SFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYG
FQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEV
PVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICG
DSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDE
MIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQ
IDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIIT
TDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSC
CSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Dissolve in a minimum amount of pure DMSO (approx. 80µL) and dilute with water to the desired concentration. Please pay attention that the final concentration of DMSO must be below 1% (v/v) to avoid toxicity in the biological system.

UniProt: P0DTC2

Weitere Artikel passend zu "SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides"
Specifications: Pool of 2x 158 peptides (316 peptides) (15mers with 11 aa overlap) Quantity:... mehr
 

Technische Daten:

Specifications:
Pool of 2x 158 peptides (316 peptides) (15mers with 11 aa overlap)
Quantity: approx. 25µg per peptide (7.9mg in total)
Peptides supplied as trifluoro acetate salts
Quality check: by ESI-MS

UniProt: P0DTC2

Applikation:

T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides. Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.