Variante Omicron B.1.1.529 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)

Variante Omicron B.1.1.529 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)


Artikel-Nr.: P2780.0315

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

795,00 € *
Dieser Peptidpool der neuen Omicron-Variante von SARS-CoV-2 (315 Peptide, aufgeteilt in zwei... mehr
Produktinformationen "Variante Omicron B.1.1.529 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)"

Dieser Peptidpool der neuen Omicron-Variante von SARS-CoV-2 (315 Peptide, aufgeteilt in zwei Subpools von 158 und 157 Peptiden) umfasst das gesamte Spike-Glykoprotein mit allen Mutationen.

Die Peptide dieses Produkts werden lyophilisiert als Trifluoracetat-Salze geliefert.

Jeder ESI-MS-geprüfte Peptidpool wird durch Festphasenextraktion gereinigt.

Peptide Scan 15/11
Länge: 1270 Aminosäuren
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVISGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKV
CEFQFCNDPFLDHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIVREPEDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT
AGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKL
NDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLKSYGFQPTYGVGHQPYRVVVLSF
ELLHAPATVCGPKKSTNLVKNKCVNFNFNGLKGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVF
QTRAGCLIGAEYVNNSYECDIPIGAGICASYQTQTKSHRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLKRALTGIA
VEQDKNTQEVFAQVKQIYKTPPIKYFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFKGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFA
MQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNHNAQALNTLVKQLSSKFGAISSVLNDIFSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAAT
KMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKY
FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Weitere Artikel passend zu "Variante Omicron B.1.1.529 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein)"
Specifications: Pool of 315 peptides Purity: Each peptide ESI-MS checked, pool is purified by... mehr
 

Technische Daten:

Specifications:
Pool of 315 peptides
Purity: Each peptide ESI-MS checked, pool is purified by solid phase extraction.
Sequences: see separate document
Amount: 25µg each peptide (7875µg for complete pool)
Counter ion: TFA
UniProt ID: P0DTC2

Lyophilized white powder

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

Dokumente - Protokolle - Downloads mehr


Dokumente - Protokolle - Downloads

Hier finden Sie Informationen und weiterführende Literatur zu Variante Omicron B.1.1.529 Peptid Pool SARS-CoV-2 full length (Spike Glycoprotein). Für weitere Dokumente (Zertifikate mit weiteren Lotnummern, Sicherheitsdatenblätter in anderer Sprache, weitere Produktinformationen) wenden Sie sich bitte an Genaxxon biosience unter: info@genaxxon.com oder Tel.: +49 731 3608 123.