SARS-CoV-2 (N-Protein) - Peptid-Pool

SARS-CoV-2 (N-Protein) - Peptid-Pool


Artikel-Nr.: P4015.0102

Shipping: shipped at RT, stored at -20°C

Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.

262,65 € *
Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools... mehr
Produktinformationen "SARS-CoV-2 (N-Protein) - Peptid-Pool"

Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap - UniProt: P0DTC9) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).

Length: 419 amino acids - peptide scan 15/11
Sequence:
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKD
GIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASK
KPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQ
RQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Weitere Artikel passend zu "SARS-CoV-2 (N-Protein) - Peptid-Pool"
Specifications: Pool of 102 peptides of Covid-19 N-Protein  Quantity: approx. 25µg per... mehr
 

Technische Daten:

Specifications:
Pool of 102 peptides of Covid-19 N-Protein 
Quantity: approx. 25µg per peptide (2.6mg in total)
Peptides supplied as trifluoro acetate salts
Quality check: by ESI-MS

Protein ID: P0DTC9 (swiss prot)

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

Dokumente - Protokolle - Downloads mehr


Dokumente - Protokolle - Downloads

 
 
 
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

Dissolve in a minimum amount of pure DMSO (approx. 40μL) and dilute with water to the desired concentration. Please pay attention that the final concentration of DMSO must be below 1% (v/v) to avoid toxicity in the biological assay.