SARS-CoV-2 (N-Protein) - Peptid-Pool

Artikel-Nr.: P4015.0102
Shipping: shipped at RT, stored at -20°C Lieferzeit: 3 - 8 Werktage
Für genaue Informationen zum Liefertermin wenden Sie sich bitte an Genaxxon.
Preise zzgl. gesetzlicher MwSt. zzgl. Versandkosten
Infos Lieferbedingungen & Versandkosten >>
Peptide pool of 102 overlapping peptides of the Nucleoprotein of SARS-CoV-2. The peptide pools is derived from a peptide scan (15mers with 11 aa overlap - UniProt: P0DTC9) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).
Length: 419 amino acids - peptide scan 15/11
Sequence:
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKD
GIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASK
KPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQ
RQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Technische Daten:
Specifications:
Pool of 102 peptides of Covid-19 N-Protein
Quantity: approx. 25µg per peptide (2.6mg in total)
Peptides supplied as trifluoro acetate salts
Quality check: by ESI-MS
Protein ID: P0DTC9 (swiss prot)
Sicherheits Hinweise / Safety
Klassifizierungen / Classification
Dokumente - Protokolle - Downloads
Dissolve in a minimum amount of pure DMSO (approx. 40μL) and dilute with water to the desired concentration. Please pay attention that the final concentration of DMSO must be below 1% (v/v) to avoid toxicity in the biological assay.