0,00 €*
Positionen anzeigen
 
 
Zurück
Vor
Kontrollpeptid Amyloid-beta (40-1) human

Kontrollpeptid Amyloid-beta (40-1) human

Gewicht

Wählen Sie bitte die gewünschte Packungsgröße aus.

Reinheit

Wählen Sie bitte die gewünschte Reinheit aus.

Hersteller Genaxxon bioscience



Artikel-Nr.: P2252.0001

shipped at RT, store at -20°C

 

Sofort versandfertig, Lieferzeit ca. 1-2 Werktage

220,60 € *
 
 
 
 
 

Produktinformationen "Kontrollpeptid Amyloid-beta (40-1) human"

Amyloid-ß-peptides: Characteristic of Alzheimer disease is the accumulation of amyloid plaques in the brain. The major components of these plaques are 39-42 residue-long amyloid-ß-peptides, which form insoluble fibrils via self-assembly. The amyloid-ß-peptides are fragments of the broadly distributed, membrane-bound amyloid precursor protein APP, encoded on chromosome 21. They are formed from the proteolytic cleavage of APP by ß- and g-secretases. Cleavage occurs after residue 40 or after residue 42. Even slightly increased amounts of amyloid-ß1-42 are described to be sufficient to cause Alzheimer's disease.

 
 
 

Technische Daten:

Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD; Purity: >95% (HPLC).

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90

Dokumente - Protokolle - Downloads

Hier finden Sie Infos und weiterführende Literatur zu Kontrollpeptid Amyloid-beta (40-1) human

   Zertifikate

  Produktbeschreibungen

   Allg. Daten 2

   Kategorienlisten

 
 
 

Kundenbewertungen für "Kontrollpeptid Amyloid-beta (40-1) human"

 
Bewertungen werden nach Überprüfung freigeschaltet.

Bewertung schreiben

 
 
 
 
 
 
 

Die mit einem * markierten Felder sind Pflichtfelder.

 
 
Amyloid-beta (1-40) human

ab 220,60 € *

esiCRISPR Kit-wt

550,00 € *

Cas9-Dead-NLS-EGFP

ab 258,00 € *

Cas9-NLS-tagRFP - Cas9 mit rot...

ab 258,00 € *

Cas9-NLS-EGFP

ab 258,00 € *

LyoBeads - vorportioniert in...

ab 5,00 € * Statt: 11,00 € *

LyoCake - Lyophilisierter qPCR...

ab 25,00 € *

Cas9-Nickase-NLS

ab 234,00 € *

MOG (35-55) Ratte/Maus -...

319,56 € * Statt: 375,95 € *

GreenMasterMix (2X) Low ROX für...

ab 20,00 € * Statt: 75,00 € *

Cas9-NLS (CRISPR associated...

ab 234,00 € *

HiDiTaq DNA-Polymerase

ab 15,00 € *

HiDi DNA-Polymerase

ab 15,00 € *

GenaxxoFect-plus...

ab 77,18 € *

esiRNA - Negative Controls

ab 174,00 € *

rek. humanes Serumalbumin (rHSA)

ab 254,68 € *

GenaxxoFect Transfektionsreagenz

ab 57,29 € *

GreenMasterMix (2X) ohne ROX für...

ab 20,00 € * Statt: 75,00 € *

Taq DNA Polymerase S (Hohe...

ab 10,00 € * Statt: 25,00 € *

esiRNA - Positive Controls

ab 174,00 € *

CRISPRfect E...

144,00 € *

D-Arg9 (r9)

ab 263,37 € *

Nona-Arginin - Arg9 (R9)

ab 141,25 € *

Influenza A NP (366-374) -...

ab 145,23 € *