humanes LL-37 antimikrobielles Peptid

humanes LL-37 antimikrobielles Peptid


Artikel-Nr.: P2299.7005

Shipping: shipped at RT, store at -20°C

Sofort versandfertig, Lieferzeit ca. 1-2 Werktage

185,00 € *

Gewicht:

Wählen Sie bitte die gewünschte Packungsgröße aus.

Reinheit:

Wählen Sie bitte die gewünschte Reinheit aus.

LL-37 is a muntifunctional host defense peptide with antibacterial, antiviral, and... mehr
Produktinformationen "humanes LL-37 antimikrobielles Peptid"

LL-37 is a muntifunctional host defense peptide with antibacterial, antiviral, and immunomodulating activities. It is the only cathelicidin-type peptide found in human. In addition to its antimicrobial activities, LL-37 has been found to regulate inflammation and neutralize lipopolysaccharides from Gram-negative bacteria. Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.

Amino acid sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser)

Weitere Artikel passend zu "humanes LL-37 antimikrobielles Peptid"
Purity: >95% (HPLC); lyophilized powder; Sequence: [LL-37, 37 aa] mehr
 

Technische Daten:

Purity: >95% (HPLC); lyophilized powder; Sequence: [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser); C205H341N61O52; MW = 4493.3 g/mol.

Applikation:

LL-37 is used to study host defense mechanisms.

Quelle

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads mehr

Dokumente - Protokolle - Downloads

 
 
 
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "humanes LL-37 antimikrobielles Peptid"
Bewertung schreiben
Bewertungen werden nach Überprüfung freigeschaltet.
Bitte geben Sie die Zeichenfolge in das nachfolgende Textfeld ein.

Die mit einem * markierten Felder sind Pflichtfelder.

Dermcidin, DCD-1 (SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSV) Dermcidin, DCD-1...
ab 365,00 € *
Dermcidin, DCD-1L (SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL) Dermcidin, DCD-1L...
ab 365,00 € *
Cas9-NLS-EGFP Cas9-NLS-EGFP
ab 258,00 € *
Cas9-Dead-NLS Protein Cas9-Dead-NLS Protein
ab 234,00 € *
Cas9-Nickase-NLS Cas9-Nickase-NLS
ab 234,00 € *
TIPP!
Phage T7 DNA Phage T7 DNA
ab 85,06 € *
L-Asparaginase L-Asparaginase
ab 170,89 € *
Premium dNTPs at low prices dNTP-Set (Na-Salz) - 100 mM Lösung
ab 25,00 € * 50,00 € *
TIPP!
TIPP!
TIPP!
Taq Polymerase from Genaxxon Taq DNA Polymerase S (Hohe Genauigkeit)
ab 10,00 € * 25,00 € *