Alzheimer Peptide with successful phase I trial

As reported by transcript (https://transkript.de/news/qiagen-mitgruender-investiert-in-priavoid.html) the company Priavoid based in
Jülich (Germany) (https://priavoid.com/) has successfully completed phase I using special peptides for treatment of Alzheimer's disease.

The approach is based on D-enantiomeric peptides, that mirror the naturally occurring peptides based on L-amino acids.
The active ingredient directly destroys toxic β-amyloid oligomers and breaks them down into the harmless β-amyloid
monomers without the involvement of the immune system.

If you are interested in peptides consisting of D-amino acids, you are welcome to contact Genaxxon: info@genaxxon.com or just have a look at: https://www.genaxxon.com/shop-all-products/peptide-proteins/ or https://www.genaxxon.com/shop-all-products/peptide-proteins/alzheimer-peptide/ to get an idea about the vast range of peptides Genaxxon bioscience can offer.

Please enter these characters in the following text field.

The fields marked with * are required.

Related products
Ac-KLVFF-NH2 Ac-KLVFF-NH2
From €154.08 *
Alzheimer Peptide NYSKMIFSHHHH Peptide: NYSKMIFSHHHH
From €154.08 *
Amyloid-beta (1-42), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Amyloid-beta (1-42), rat...
From €636.03 * €650.00 *