ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Order number: P2612.9505
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.
Quantity | Unit price |
---|---|
To 2 | €465.00 * |
From 3 | €441.75 * |
*Prices plus VAT plus shipping costs
ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is a synthetic peptide according to the first 39 amino acids of the human hormone ACTH/Adrenocorticotropic hormone. Adrenocorticotropic hormone stimulates the adrenal cortex. More specifically, it stimulates secretion of glucocorticoids such as cortisol, and has little control over secretion of aldosterone, the other major steroid hormone from the adrenal cortex. Stimulates secretion of adrenal corticosteroids and induces growth of adrenal cortex. ACTH also called Tetracosactide directly activates G-proteins. It is also a stimulator of adenylate cyclase and cAMP formation.
Technical Data:
Specifications:
Purity: >95% (HPLC, 214nm)
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence (three letter code): Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
chemical formula: C207H308N56O58S
Molecular Weight: 4541.13 g/mol
Appearance: lyophilized white powder
Sicherheits Hinweise / Safety
Klassifizierungen / Classification
eclass-Nr: 32-16-04-09Dokumente - Protokolle - Downloads
Here you will find information and further literature on ACTH (1-39), human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.