Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)

Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)


Order number: P2784.0315

Shipping: shipped at RT, store at -20°C

Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

GENAXXON Jubilee 20th Anniversary

 

€826.58 *
This peptide pool of the omicron variant B.1.1.529 BA.5 of SARS-CoV-2 (315... more
Product information "Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)"

This peptide pool of the omicron variant B.1.1.529 BA.5 of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole spike glycoprotein with all mutations.

Possilbe applications: T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response.

Each peptide is purified by solid phase extraction and checked on its purity by ESI-MS.
The peptides of this product are supplied lyophilized as trifluoro acetate salts.

Peptide Scan 15/11
Length: 1270 amino acids
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVISGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKV
CEFQFCNDPFLDHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIVREPEDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT
AGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKL
NDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLKSYGFQPTYGVGHQPYRVVVLSF
ELLHAPATVCGPKKSTNLVKNKCVNFNFNGLKGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVF
QTRAGCLIGAEYVNNSYECDIPIGAGICASYQTQTKSHRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLKRALTGIA
VEQDKNTQEVFAQVKQIYKTPPIKYFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFKGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFA
MQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNHNAQALNTLVKQLSSKFGAISSVLNDIFSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAAT
KMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKY
FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

More products around "Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)"
Specifications: Pool of 315 peptides Purity: Each peptide ESI-MS checked, pool is purified by... more
 

Technical Data:

Specifications:
Pool of 315 peptides
Purity: Each peptide ESI-MS checked, pool is purified by solid phase extraction.
Sequences: see separate document
Amount: 15 nmol (approx. 25ug)/peptide for stimulation of 2,5 x 10E8 cells (7875µg for complete pool)
Counter ion: TFA
UniProt ID: P0DTC2

Lyophilized white powder

application:

For T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 34-16-04-90
Dokumente - Protokolle - Downloads more


Dokumente - Protokolle - Downloads

Here you will find information and further literature on Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein). For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.