Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)

Genaxxon bioscience

Advantages at a glance

High-quality products
Customized solutions
Personal contact
Fast service
Competent technical support +49(0)731-3608-123

GENAXXON Jubilee 20th Anniversary

€836.58*

Prices excl. VAT plus shipping costs

pack size

peptide pool

Product number: P2780.0315
Delivery time: 3- 8 working days
For detailed information on the delivery date, please contact Genaxxon.

Shipment: not cooled. Store at -20°C. For laboratory usage only!

Product information "Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)"

This peptide pool of the omicron variant of SARS-CoV-2 (315 peptides, delivered in two subpools of 158 & 157 peptides) that covers the whole spike glycoprotein with all mutations.

Possilbe applications: T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response.

Each peptide is purified by solid phase extraction and checked on its purity by ESI-MS.
The peptides of this product are supplied lyophilized as trifluoro acetate salts.

Peptide Scan 15/11
Length: 1270 amino acids
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVISGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSK
TQSLLIVNNATNVVIKVCEFQFCNDPFLDHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIVREPEDLPQGFSALE
PLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCP
FDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSG
NYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLKSYGFQPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLKGTGVLTESN
KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEYVNNSYECDIPIG
AGICASYQTQTKSHRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLKRALTGIAVEQDKNTQ
EVFAQVKQIYKTPPIKYFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFKGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGA
ALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNHNAQALNTLVKQLSSKFGAISSVLNDIFSRLDKVEAEVQIDRLITGRLQSLQ
TYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQ
IITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIV
MVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Gene:	S
No Peptides:	315 peptides
Amount Peptide:	25 µg
Amount Aliquote:	7,875 mg
Uniprot Id:	P0DTC2
Solubility:	Dissolve in a minimum amount of pure DMSO (approx. 40μl) and dilute with water to the desired concentration. Please pay attention that the final concentration of DMSO must be below 1% (v/v) to avoid toxicity in the biological
Storage:	Store at -20°C
Purity:	Each peptide ESI-MS checked, pool is purified by solid phase extraction
Counter Ion:	TFA
Protein:	Spike glycoprotein
Species:	Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Application :	T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication :	Covid-19, Infection, Respiratory infection

Applikation / Application:

T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response

Einheiten / Units:

Quelle / Source:

synthetic

Sicherheits Hinweise / Safety

Klassifizierungen / Classification

eclass-Nr: 32-16-04-09

Documents - Protocols - Downloads :

Here you will find information and further literature. For further documents (certificates with additional lot numbers, safety data sheets in other languages, further product information) please contact Genaxxon biosience at: info@genaxxon.com or phone: +49 731 3608 123.

Documents:

Safety Data Sheet
Certificate
Product description